KEGG   Homo sapiens (human): 22918
Entry
22918             CDS       T01001                                 

Symbol
CD93, C1QR1, C1qR(P), C1qRP, CDw93, ECSM3, MXRA4, dJ737E23.1
Name
(RefSeq) CD93 molecule
  KO
K06702  CDW93 antigen
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    22918 (CD93)
   04091 Lectins [BR:hsa04091]
    22918 (CD93)
CD molecules [BR:hsa04090]
 Proteins
  22918 (CD93)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 14: Thrombomodulin
   22918 (CD93)
SSDB
Motif
Pfam: cEGF EGF_CA FXa_inhibition EGF Lectin_C EGF_3 hEGF TMEM51 TRAP_alpha TMEM154 TMEMspv1-c74-12 OAD_gamma SIT EphA2_TM ETRAMP DUF2207
Other DBs
NCBI-GeneID: 22918
NCBI-ProteinID: NP_036204
OMIM: 120577
HGNC: 15855
Ensembl: ENSG00000125810
Vega: OTTHUMG00000032058
Pharos: Q9NPY3(Tbio)
UniProt: Q9NPY3
Position
20p11.21
AA seq 652 aa
MATSMGLLLLLLLLLTQPGAGTGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNL
ATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGG
EDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVC
KFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLC
KEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTC
ASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVN
TPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGE
DGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGP
PDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGS
PGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKLLLFYILGTVVAILLLLALA
LGLLVYRKRRAKREEKKEKKPQNAADSYSWVPERAESRAMENQYSPTPGTDC
NT seq 1959 nt   +upstreamnt  +downstreamnt
atggccacctccatgggcctgctgctgctgctgctgctgctcctgacccagcccggggcg
gggacgggagctgacacggaggcggtggtctgcgtggggaccgcctgctacacggcccac
tcgggcaagctgagcgctgccgaggcccagaaccactgcaaccagaacgggggcaacctg
gccactgtgaagagcaaggaggaggcccagcacgtccagcgagtactggcccagctcctg
aggcgggaggcagccctgacggcgaggatgagcaagttctggattgggctccagcgagag
aagggcaagtgcctggaccctagtctgccgctgaagggcttcagctgggtgggcgggggg
gaggacacgccttactctaactggcacaaggagctccggaactcgtgcatctccaagcgc
tgtgtgtctctgctgctggacctgtcccagccgctccttcccagccgcctccccaagtgg
tctgagggcccctgtgggagcccaggctcccccggaagtaacattgagggcttcgtgtgc
aagttcagcttcaaaggcatgtgccggcctctggccctggggggcccaggtcaggtgacc
tacaccacccccttccagaccaccagttcctccttggaggctgtgccctttgcctctgcg
gccaatgtagcctgtggggaaggtgacaaggacgagactcagagtcattatttcctgtgc
aaggagaaggcccccgatgtgttcgactggggcagctcgggccccctctgtgtcagcccc
aagtatggctgcaacttcaacaatgggggctgccaccaggactgctttgaagggggggat
ggctccttcctctgcggctgccgaccaggattccggctgctggatgacctggtgacctgt
gcctctcgaaacccttgcagctccagcccatgtcgtgggggggccacgtgcgtcctggga
ccccatgggaaaaactacacgtgccgctgcccccaagggtaccagctggactcgagtcag
ctggactgtgtggacgtggatgaatgccaggactccccctgtgcccaggagtgtgtcaac
acccctgggggcttccgctgcgaatgctgggttggctatgagccgggcggtcctggagag
ggggcctgtcaggatgtggatgagtgtgctctgggtcgctcgccttgcgcccagggctgc
accaacacagatggctcatttcactgctcctgtgaggagggctacgtcctggccggggag
gacgggactcagtgccaggacgtggatgagtgtgtgggcccggggggccccctctgcgac
agcttgtgcttcaacacacaagggtccttccactgtggctgcctgccaggctgggtgctg
gccccaaatggggtctcttgcaccatggggcctgtgtctctgggaccaccatctgggccc
cccgatgaggaggacaaaggagagaaagaagggagcaccgtgccccgtgctgcaacagcc
agtcccacaaggggccccgagggcacccccaaggctacacccaccacaagtagaccttcg
ctgtcatctgacgcccccatcacatctgccccactcaagatgctggcccccagtgggtcc
ccaggcgtctggagggagcccagcatccatcacgccacagctgcctctggcccccaggag
cctgcaggtggggactcctccgtggccacacaaaacaacgatggcactgacgggcaaaag
ctgcttttattctacatcctaggcaccgtggtggccatcctactcctgctggccctggct
ctggggctactggtctatcgcaagcggagagcgaagagggaggagaagaaggagaagaag
ccccagaatgcggcagacagttactcctgggttccagagcgagctgagagcagggccatg
gagaaccagtacagtccgacacctgggacagactgctga

DBGET integrated database retrieval system