KEGG   Homo sapiens (human): 22920Help
Entry
22920             CDS       T01001                                 

Gene name
KIFAP3, FLA3, KAP-1, KAP-3, KAP3, SMAP, Smg-GDS, dJ190I16.1
Definition
(RefSeq) kinesin associated protein 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: KAP Arm RICTOR_M Herpes_UL33 FPL
Motif
Other DBs
NCBI-GeneID: 22920
NCBI-ProteinID: NP_055785
OMIM: 601836
HGNC: 17060
Ensembl: ENSG00000075945
Vega: OTTHUMG00000035947
Pharos: Q92845(Tbio)
UniProt: Q92845
Position
1q24.2
AA seq 792 aa AA seqDB search
MQGEDARYLKRKVKGGNIDVHPSEKALIVHYEVEATILGEMGDPMLGERKECQKIIRLKS
LNANTDITSLARKVVEECKLIHPSKLNEVEQLLYYLQNRRDSLSGKEKKEKSSKPKDPPP
FEGMEIDEVANINDMDEYIELLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALA
RVLREDWKQSVELATNIIYIFFCFSSFSQFHGLITHYKIGALCMNIIDHELKRHELWQEE
LSKKKKAVDEDPENQTLRKDYEKTFKKYQGLVVKQEQLLRVALYLLLNLAEDTRTELKMR
NKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLVKMIPCEHEDL
LNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALLGNDNYKQIAMCVLYHISMDDRFKSMF
AYTDCIPQLMKMLFECSDERIDLELISFCINLAANKRNVQLICEGNGLKMLMKRALKFKD
PLLMKMIRNISQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLDWEL
VLKEYKLVPYLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNA
QQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDII
AEYDEEWAKKIQSEKFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDL
FYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGF
RPDEPYYYGYGS
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggggaggacgccagatacctcaaaaggaaagttaaaggagggaatatagatgta
catccatcagaaaaagcactcattgttcactatgaagtggaagctaccattcttggagaa
atgggggaccccatgttgggagaacgaaaagaatgtcaaaaaatcattcgacttaagagt
ctcaatgccaacacagatataacttccctggcaaggaaggtggttgaagaatgtaaactc
attcatccttcaaaactaaatgaggtagaacagctgttgtactatctacagaaccgccgt
gattcattgtcaggaaaagagaaaaaagaaaaatcaagcaagcctaaagatccacctcct
tttgaaggaatggagattgatgaagttgctaacattaatgacatggatgaatatattgag
ttattatatgaagatattcctgacaaagttcggggttctgctttgatcctgcagcttgct
cgaaatcctgataacttggaagaactactattgaatgaaactgcccttggtgcattagca
agggtcctgagagaagactggaagcaaagtgtcgagttagctacaaacataatttacatc
tttttttgtttctccagcttttctcaatttcatggacttattactcactataaaattgga
gctctgtgtatgaatattattgatcatgagttaaaaagacatgagctttggcaagaagaa
ctctcaaagaagaagaaagctgttgatgaagaccctgaaaaccaaaccttgagaaaggat
tatgaaaaaacctttaaaaagtaccaggggcttgtggtaaaacaggaacagctattacga
gttgctctttatttgcttctgaatcttgctgaggatactcgtaccgaactgaaaatgagg
aacaagaacatagttcacatgttggtgaaagcccttgatcgggacaattttgagctgcta
attttagttgtgtcattcttgaagaaactcagcatttttatggagaataaaaatgatatg
gtggaaatggatattgttgaaaaactggtgaaaatgataccttgtgagcatgaagacctg
ctgaatatcaccctccgacttttactaaacctatcctttgacacaggactgaggaataag
atggtacaagttggactgcttcccaagctcactgcactcctaggcaatgacaactacaaa
caaatagcaatgtgtgttctttaccacataagcatggatgaccgctttaaatcaatgttt
gcatacactgactgtataccacagttaatgaagatgctgtttgaatgttcagatgaacga
attgacttggaactcatttctttctgcattaatcttgctgctaacaaaagaaatgtacag
cttatctgtgaaggaaatgggctgaagatgctcatgaagagggctctgaagtttaaggat
ccattgctgatgaaaatgattagaaacatttctcagcatgatggaccaactaaaaatctg
tttattgattatgttggggaccttgcagcccagatctctaatgatgaagaagaggagttt
gtgattgaatgtttgggaactcttgcaaacttgaccattccagacttagactgggaattg
gttcttaaagaatataagttggttccatacctcaaggataaactaaaaccaggtgctgca
gaagatgatcttgttttagaagtggttataatgattggaactgtatccatggatgactct
tgtgctgcattgctagccaaatctggcataatccctgcactcattgaattgctaaatgct
caacaagaagatgatgaatttgtgtgtcagataatttatgtcttctaccagatggttttc
caccaagccacaagagacgtcataatcaaggaaacacaggctccagcatatctcatagac
ctaatgcatgataagaataatgaaatccgaaaggtctgtgataatacattagatattata
gcggaatatgatgaagaatgggctaagaaaattcagagtgaaaagtttcgctggcataac
tctcagtggctggagatggtagagagtcgtcagatggatgagagtgagcagtacttgtat
ggtgatgatcgaattgagccatacattcatgaaggagatattctcgaaagacctgacctt
ttctacaactcagatggattaattgcctctgaaggagccataagtcccgatttcttcaat
gattaccaccttcaaaatggagatgttgttgggcagcattcatttcctggcagccttgga
atggatggctttggccaaccagttggcattcttggacgccctgccacagcatatggattc
cgccctgatgaaccttactactatggctatggatcttga

DBGET integrated database retrieval system