KEGG   Homo sapiens (human): 22925Help
Entry
22925             CDS       T01001                                 

Gene name
PLA2R1, CLEC13C, PLA2-R, PLA2G1R, PLA2IR, PLA2R
Definition
(RefSeq) phospholipase A2 receptor 1
  KO
K06560  mannose receptor, C type
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    22925 (PLA2R1)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    22925 (PLA2R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22925 (PLA2R1)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    22925 (PLA2R1)
   04090 CD molecules [BR:hsa04090]
    22925 (PLA2R1)
   04091 Lectins [BR:hsa04091]
    22925 (PLA2R1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    22925 (PLA2R1)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   22925 (PLA2R1)
CD molecules [BR:hsa04090]
 Proteins
  22925 (PLA2R1)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 6: Mannose receptor family
   22925 (PLA2R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C fn2 UL45 Xlink Chordopox_A33R
Motif
Other DBs
NCBI-GeneID: 22925
NCBI-ProteinID: NP_031392
OMIM: 604939
HGNC: 9042
Ensembl: ENSG00000153246
Vega: OTTHUMG00000154087
Pharos: Q13018(Tbio)
UniProt: Q13018
Position
2q24.2
AA seq 1463 aa AA seqDB search
MLLSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLT
LENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRK
MITGPLQYSVQVAHDNTVVASRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMF
PFQYNHQWHHECTREGREDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSH
ICYQFNLLSSLSWSEAHSSCQMQGGTLLSITDETEENFIREHMSSKTVEVWMGLNQLDEH
AGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSFMPSAWRSRDCESTLPYICKKYLNH
IDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLA
EVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVS
AEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQAS
SGYYCPPALVTITNRFEQAFITSLISSVVKMKDSYFWIALQDQNDTGEYTWKPVGQKPEP
VQYTHWNTHQPRYSGGCVAMRGRHPLGRWEVKHCRHFKAMSLCKQPVENQEKAEYEERWP
FHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCEEFGAHLASFAHIEEENFVNE
LLHSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLDNTYFGEDARNCAVYKAN
KTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVC
SWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWD
TGRERTVNNQSQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPK
GWLYFNYKCLLLNIPKDPSSWKNWTHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTS
VWIGLQNDDYETWLNGKPVVYSNWSPFDIINIPSHNTTEVQKHIPLCALLSSNPNFHFTG
KWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLEYGNRTYKIINANMTWYAAIK
TCLMHKAQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDGTKSSFTFWKD
EESSLLGDCVFADSNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSN
CYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFD
GNNETIKWFDGTPTDQSNWGIRKPDTDYFKPHHCVALRIPEGLWQLSPCQEKKGFICKME
ADIHTAEALPEKGPSHSIIPLAVVLTLIVIVAICTLSFCIYKHNGGFFRRLAGFRNPYYP
ATNFSTVYLEENILISDLEKSDQ
NT seq 4392 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtcgccgtcgctgctgctgctgctgctgctgggggcgccgcggggctgcgcc
gagggtgtggcggcggcgcttacccccgagcggctcctggagtggcaggataaaggaata
tttgttatccaaagtgagagtctcaagaaatgcattcaagcaggtaaatcggttctgacc
ctggagaactgcaagcaagcaaacaagcacatgctgtggaaatgggtttcaaaccatggc
ctctttaacataggaggcagtggttgcctgggcctgaatttctccgccccagagcagcca
ttaagcttatatgaatgtgactccaccctcgtttccttacggtggcgctgtaacaggaag
atgatcacaggcccgctgcagtactctgtccaggtggcgcatgacaacacagtggtggcc
tcacggaagtatattcataagtggatttcttatgggtcaggtggtggagacatttgtgaa
tatctacacaaagatttgcatacaatcaaagggaacacccacgggatgccgtgtatgttt
cccttccagtataaccatcagtggcatcatgaatgtacccgtgaaggtcgggaagatgac
ttactgtggtgtgccacgacaagccgttatgaaagagatgaaaagtggggattttgccct
gatcccacctctgcagaagtaggttgtgatactatttgggagaaggacctcaattcacac
atttgctaccagttcaacctgctttcatctctctcttggagtgaggcacattcttcatgc
cagatgcaaggaggtacgctgttaagtattacagatgaaactgaagaaaatttcataagg
gagcacatgagcagtaaaacagtggaggtgtggatgggcctcaatcagctggatgaacac
gctggctggcagtggtctgatggaacgccgctcaactatctgaattggagcccagaggta
aattttgagccatttgttgaagatcactgtggaacatttagttcatttatgccaagtgcc
tggaggagtcgggattgtgagtccaccttgccatatatatgtaaaaaatatctaaaccac
attgatcatgaaatagttgaaaaagatgcgtggaaatattatgctacccactgtgagcct
ggctggaatccctacaatcgtaattgctacaaacttcagaaagaagaaaagacctggcat
gaggctctgcgttcttgtcaggctgataacagtgcattaatagacataacctcattagca
gaggtggagtttcttgtaaccctccttggagatgaaaatgcatcagaaacatggattggt
ttgagcagcaataaaattccagtttcctttgaatggtctaatgactcttcagtcatcttt
actaattggcacacacttgagccccacatttttccaaatagaagccagctgtgtgtctca
gcagagcagtctgagggacactggaaagtcaaaaattgtgaagaaagacttttttacatt
tgtaaaaaagcaggccatgtcctctctgatgctgaatcaggatgtcaagagggatgggag
agacatggtggattctgttacaaaattgacacagtccttcgaagctttgaccaagcttcc
agcggttattactgtcctcctgcacttgtaaccattacaaacaggtttgaacaggctttt
attaccagtttgatcagtagtgtggtaaaaatgaaggacagttatttttggatagctctt
caggaccaaaatgatacgggagaatacacttggaagccagtagggcagaaacccgagccg
gtgcagtacacacactggaacacacaccagccgcgctacagtggtggctgtgttgccatg
cgaggaaggcatccacttggtcgctgggaagtgaagcactgtcggcactttaaggcaatg
tccttgtgcaagcagccagttgaaaatcaggaaaaagcagagtatgaagagagatggccc
tttcacccctgctatttggactgggagtcagagcctggtctggccagttgcttcaaggta
tttcatagtgaaaaagttctgatgaaaagaacatggagagaagctgaagcattttgcgaa
gaatttggagctcatcttgcaagctttgcccatattgaggaagagaattttgtgaatgag
ctcttacattcaaaatttaattggacagaagaaaggcagttctggattggatttaataaa
agaaacccactgaatgccggctcatgggagtggtctgatagaactcctgttgtctcttcg
tttttagacaacacttattttggagaagatgcaagaaactgtgctgtttataaggcaaac
aaaacattgctgcccttacactgtggttccaaacgtgaatggatatgcaaaatcccaaga
gatgtgaaacccaagattccgttctggtaccagtacgatgtaccctggctcttttatcag
gatgcagaatacctttttcatacctttgcctcagaatggttgaactttgagtttgtctgt
agctggctgcacagtgatcttctcacaattcattctgcacatgagcaagaattcatccac
agcaaaataaaagcgctatcaaagtatggtgcaagttggtggattggacttcaagaagaa
agagccaatgatgaatttcgctggagagatggaacaccagtgatataccagaactgggac
acaggaagagaaagaactgtgaataatcagagccagagatgtggctttatttcttctata
acaggactctggggtagtgaagagtgttcagtttctatgcctagtatctgtaagcgaaaa
aaggtttggctcatagagaaaaagaaagatacaccaaaacaacatggaacgtgtcccaaa
ggatggctatattttaactataagtgccttctgctgaatatccccaaagacccaagcagt
tggaagaactggacgcatgctcaacatttctgtgctgaagaaggggggaccctggtcgcc
attgaaagtgaggtggagcaagctttcattactatgaatctttttggccagaccaccagt
gtgtggataggtttacaaaatgatgattatgaaacatggctaaatggaaagcctgtggta
tattctaactggtctccatttgatataataaatattccaagtcacaataccactgaagtt
cagaaacacattcctctctgtgccttactctcaagtaatcctaattttcatttcactgga
aaatggtattttgaagactgtggaaaggaaggctatgggtttgtttgtgaaaaaatgcaa
gatacttctggacacggtgtaaatacatctgatatgtatccaatgcccaataccttagaa
tatggaaacagaacttacaaaataattaatgcaaatatgacttggtatgcagcaataaaa
acctgcctgatgcacaaagcacaactggtcagcatcacagaccagtatcaccagtccttc
ctcactgttgtcctcaaccggctaggatatgcccactggattggactgttcaccacagat
aatggtcttaattttgactggtctgatggcaccaaatcttctttcactttttggaaagat
gaggagtcctccctccttggtgactgcgtttttgccgacagcaacggacgctggcatagc
acagcctgcgagtcatttctgcaaggtgccatttgtcatgtgccacctgaaacaagacaa
tctgaacacccagagttgtgctcagaaacatctattccctggataaaatttaaaagtaat
tgctacagtttttctacagtcctagacagtatgagttttgaggctgctcatgaattttgc
aaaaaggaaggttctaatcttttaacaatcaaggatgaggctgaaaatgcatttctccta
gaagagctgtttgcttttggttcttctgtccagatggtttggttgaatgctcaatttgat
ggtaacaatgaaaccataaagtggtttgatggaactcccacagaccagtcaaactggggc
attcggaagccagacacagactacttcaagccccatcattgtgttgccttgaggatccct
gaaggattatggcagctatccccgtgtcaagaaaaaaaaggctttatatgtaaaatggag
gcagatattcacactgcagaggcgctgccagaaaaaggaccaagtcacagcatcattcct
cttgcggttgtactgacactgatagtcattgtggccatttgcacactttccttctgcata
tacaagcataacggtggcttcttcaggagacttgcagggtttcggaatccttactatcct
gcaaccaactttagtacagtatatttagaagaaaatattctcatttctgatcttgagaag
agtgaccaataa

DBGET integrated database retrieval system