KEGG   Homo sapiens (human): 22926
Entry
22926             CDS       T01001                                 

Gene name
ATF6, ACHM7, ATF6A
Definition
(RefSeq) activating transcription factor 6
  KO
K09054  cyclic AMP-dependent transcription factor ATF-6 alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Network
nt06412  Unfolded protein response (UPR) signaling
nt06460  Alzheimer disease
nt06463  Parkinson disease
  Element
N01015  ATF4-mediated transcription
N01016  Mutation-caused aberrant PSEN1 to ATF6-mediated transcription
N01033  Mutation-caused aberrant SNCA to ATF6-mediated transcription
Disease
H00971  Achromatopsia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22926 (ATF6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22926 (ATF6)
   05012 Parkinson disease
    22926 (ATF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    22926 (ATF6)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    22926 (ATF6)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin Methyltrans_RNA Docking
Other DBs
NCBI-GeneID: 22926
NCBI-ProteinID: NP_031374
OMIM: 605537
HGNC: 791
Ensembl: ENSG00000118217
Vega: OTTHUMG00000023961
Pharos: P18850(Tbio)
UniProt: P18850 A8K383
Position
1q23.3
AA seq 670 aa
MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNL
DFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEE
LDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQ
PKPLLLPAAPKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTV
VQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNV
GSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGTLKRQLD
EVVSENQRLKVPSPKRRVVCVMIVLAFIILNYGPMSMLEQDSRRMNPSVSPANQRRHLLG
FSAKEAQDTSDGIIQKNSYRYDHSVSNDKALMVLTEEPLLYIPPPPCQPLINTTESLRLN
HELRGWVHRHEVERTKSRRMTNNQQKTRILQGALEQGSNSQLMAVQYTETTSSISRNSGS
ELQVYYASPRSYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAINI
NENVINGQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDQQRNQTNTFFGSPPAATEATH
VVSTIPESLQ
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgggggagccggctggggttgccggcaccatggagtcaccttttagcccgggactcttt
cacaggctggatgaagattgggattctgctctctttgctgaactcggttatttcacagac
actgatgagctgcaattggaagcagcaaatgagacgtatgaaaacaattttgataatctt
gattttgatttggatttgatgccttgggagtcagacatttgggacatcaacaaccaaatc
tgtacagttaaagatattaaggcagaacctcagccactttctccagcctcctcaagttat
tcagtctcgtctcctcggtcagtggactcttattcttcaactcagcatgttcctgaggag
ttggatttgtcttctagttctcagatgtctcccctttccttatatggtgaaaactctaat
agtctctcttcagcggagccactgaaggaagataagcctgtcactggtcctaggaacaag
actgaaaatggactgactccaaagaaaaaaattcaggtgaattcaaaaccttcaattcag
cccaagcctttattgcttccagcagcacccaagactcaaacaaactccagtgttccagca
aaaaccatcattattcagacagtaccaacgcttatgccattggcaaagcagcaaccaatt
atcagtttacaacctgcacccactaaaggccagacggttttgctgtctcagcctactgtg
gtacaacttcaagcacctggagttctgccctctgctcagccagtccttgctgttgctggg
ggagtcacacagctccctaatcacgtggtgaatgtggtaccagccccttcagcgaatagc
ccagtgaatggaaaactttccgtgactaaacctgtcctacaaagtaccatgagaaatgtc
ggttcagatattgctgtgctaaggagacagcaacgtatgataaaaaatcgagaatccgct
tgtcagtctcgcaagaagaagaaagaatatatgctagggttagaggcgagattaaaggct
gccctctcagaaaacgagcaactgaagaaagaaaatggaacactgaagcggcagctggat
gaagttgtgtcagagaaccagaggcttaaagtccctagtccaaagcgaagagttgtctgt
gtgatgatagtattggcatttataatactgaactatggacctatgagcatgttggaacag
gattccaggagaatgaaccctagtgtgagccctgcaaatcaaaggaggcaccttctagga
ttttctgctaaagaggcacaggacacatcagatggtattatccagaaaaacagctacaga
tatgatcattctgtttcaaatgacaaagccctgatggtgctaactgaagaaccattgctt
tacattcctccacctccttgtcagcccctaattaacacaacagagtctctcaggttaaat
catgaacttcgaggatgggttcatagacatgaagtagaaaggaccaagtcaagaagaatg
acaaataatcaacagaaaacccgtattcttcagggtgctctggaacagggctcaaattct
cagctgatggctgttcaatacacagaaaccactagtagtatcagcaggaactcagggagt
gagctacaagtgtattatgcttcacccagaagttatcaagacttttttgaagccatccgc
agaaggggagacacattttatgttgtgtcatttcgaagggatcacctgctgttaccagct
accacccataacaagaccacaagaccaaaaatgtcaattgtgttaccagcaataaacata
aatgagaatgtgatcaatgggcaggactacgaagtgatgatgcagattgactgtcaggtg
atggacaccaggatcctccatatcaaaagttcgtcagttcctccttacctccgagatcag
cagaggaatcaaaccaacaccttctttggctcccctcccgcagccacagaggcaacccac
gttgtcagcaccatccctgagtcattacaatag

DBGET integrated database retrieval system