KEGG   Homo sapiens (human): 22929
Entry
22929             CDS       T01001                                 

Gene name
SEPHS1, SELD, SPS, SPS1
Definition
(RefSeq) selenophosphate synthetase 1
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00450  Selenocompound metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    22929 (SEPHS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    22929 (SEPHS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     22929 (SEPHS1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    22929 (SEPHS1)
 Prokaryotic type
    22929 (SEPHS1)
SSDB
Motif
Pfam: AIRS_C AIRS
Other DBs
NCBI-GeneID: 22929
NCBI-ProteinID: NP_036379
OMIM: 600902
HGNC: 19685
Ensembl: ENSG00000086475
Vega: OTTHUMG00000017696
Pharos: P49903(Tbio)
UniProt: P49903
Structure
PDB: 
3FD5 3FD6

Position
10p13
AA seq 392 aa
MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAV
MPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECD
NMLMLLGVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVC
QPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMA
AVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKG
NRTARIIDKPRIIEVAPQVATQNVNPTPGATS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtctacgcgggagtcctttaacccggaaagttacgaattggacaaaagcttccggcta
accagattcactgaactgaagggcacaggctgcaaagtgccccaagatgtcctgcaaaaa
ttgctggaatctttacaggagaaccacttccaagaagatgagcagtttctgggagccgtt
atgccaaggcttggcattggaatggatacttgtgtcattcctttgaggcacggtgggctt
tccttggttcaaaccacagattacatttacccgatcgtagacgacccttacatgatgggc
aggatagcgtgtgccaatgtcctcagtgacctctatgcaatgggggtcacggaatgtgac
aatatgctgatgctccttggagtcagtaataaaatgaccgacagggaaagggataaagtg
atgcctctgattatccaaggttttaaagacgcagctgaggaagcaggaacatctgtaaca
ggcggccaaacagtactaaacccctggattgtcctgggaggagtggctaccactgtctgc
caacccaatgaatttatcatgccagacaatgcagtgccaggggacgtgctggtgctgaca
aaacccctggggacacaggtggcagtggctgtgcaccagtggctggatatccctgagaaa
tggaataagattaaactagtggtcacccaagaagatgtagagctggcctaccaggaggcg
atgatgaacatggcgaggctcaacaggacagctgcaggactcatgcacacgttcaatgcc
cacgccgccactgacatcacgggcttcgggattttgggccatgcgcagaacctggccaag
cagcagaggaacgaggtgtcgtttgtaattcacaacctcccggtgctggccaagatggct
gcggtgagcaaggcctgcggaaacatgttcggcctcatgcacgggacctgcccggagact
tcaggcggccttctgatctgtttaccacgtgagcaagcagctcggttctgtgcagagata
aagtcccccaaatatggtgaaggccaccaagcatggattattgggattgtagagaagggc
aaccgcacagccagaatcatagacaaaccccggatcatcgaggtcgcaccacaagtggcc
actcaaaatgtgaatcccacacccggggccacctcttaa

DBGET integrated database retrieval system