KEGG   Homo sapiens (human): 22932
Entry
22932             CDS       T01001                                 
Symbol
POMZP3, POM-ZP3
Name
(RefSeq) POM121 and ZP3 fusion
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Zona_pellucida POM121
Other DBs
NCBI-GeneID: 22932
NCBI-ProteinID: NP_036362
OMIM: 600587
HGNC: 9203
Ensembl: ENSG00000146707
Vega: OTTHUMG00000023514
Pharos: Q6PJE2(Tdark)
UniProt: Q6PJE2
Position
7:complement(76609986..76627279)
AA seq 187 aa
MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTV
EEEDQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITC
HLKVTLAEQDPDELNKACSFSKPSNSWFPVEGLADICQCCNKGDCGTPSHSRRQPRVVSQ
WSTSASL
NT seq 564 nt   +upstreamnt  +downstreamnt
atggtgtgtagcccagtgactctgaggatcgcccctcctgacagaagattttcgcgttct
gcgataccagagcagataatcagctcaacactgtcctcaccatcaagtaatgccccagac
ccatgtgcaaaggagactgtactgagtgccctcaaagagaagaagaagaaaaggacagtg
gaggaagaagaccaaatattccttgatggccaggaaaataaaagaagctgtcttgtcgac
ggtctcactgatgcctcttctgcattcaaagttcctcgacccgggccagatacactccag
ttcacagtggatgtcttccactttgctaatgactccagaaacatgatatacatcacctgc
cacctgaaggtcaccctagctgagcaggacccagatgaactcaacaaggcctgttccttc
agcaagccttccaacagctggttcccagtggaaggcctggctgacatctgtcaatgctgt
aacaaaggtgactgtggcactccaagccattccaggaggcagcctcgtgtcgtgagccag
tggtccacgtctgcttccctgtaa

DBGET integrated database retrieval system