KEGG   Homo sapiens (human): 22933Help
Entry
22933             CDS       T01001                                 

Gene name
SIRT2, SIR2, SIR2L, SIR2L2
Definition
(RefSeq) sirtuin 2
  KO
K11412  NAD+-dependent protein deacetylase sirtuin 2 [EC:2.3.1.286]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    22933 (SIRT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    22933 (SIRT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     22933 (SIRT2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     22933 (SIRT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2 YdjO
Motif
Other DBs
NCBI-GeneID: 22933
NCBI-ProteinID: NP_036369
OMIM: 604480
HGNC: 10886
Ensembl: ENSG00000068903
Pharos: Q8IXJ6(Tchem)
UniProt: Q8IXJ6
Structure
PDB: 

Position
19q13.2
AA seq 389 aa AA seqDB search
MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
PNPSTSASPKKSPPPAKDEARTTEREKPQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcagagccagacccctctcaccctctggagacccaggcagggaaggtgcaggaggct
caggactcagattcagactctgagggaggagccgctggtggagaagcagacatggacttc
ctgcggaacttattctcccagacgctcagcctgggcagccagaaggagcgtctgctggac
gagctgaccttggaaggggtggcccggtacatgcagagcgaacgctgtcgcagagtcatc
tgtttggtgggagctggaatctccacatccgcaggcatccccgactttcgctctccatcc
accggcctctatgacaacctagagaagtaccatcttccctacccagaggccatctttgag
atcagctatttcaagaaacatccggaacccttcttcgccctcgccaaggaactctatcct
gggcagttcaagccaaccatctgtcactacttcatgcgcctgctgaaggacaaggggcta
ctcctgcgctgctacacgcagaacatagataccctggagcgaatagccgggctggaacag
gaggacttggtggaggcgcacggcaccttctacacatcacactgcgtcagcgccagctgc
cggcacgaatacccgctaagctggatgaaagagaagatcttctctgaggtgacgcccaag
tgtgaagactgtcagagcctggtgaagcctgatatcgtcttttttggtgagagcctccca
gcgcgtttcttctcctgtatgcagtcagacttcctgaaggtggacctcctcctggtcatg
ggtacctccttgcaggtgcagccctttgcctccctcatcagcaaggcacccctctccacc
cctcgcctgctcatcaacaaggagaaagctggccagtcggaccctttcctggggatgatt
atgggcctcggaggaggcatggactttgactccaagaaggcctacagggacgtggcctgg
ctgggtgaatgcgaccagggctgcctggcccttgctgagctccttggatggaagaaggag
ctggaggaccttgtccggagggagcacgccagcatagatgcccagtcgggggcgggggtc
cccaaccccagcacttcagcttcccccaagaagtccccgccacctgccaaggacgaggcc
aggacaacagagagggagaaaccccagtga

DBGET integrated database retrieval system