KEGG   Homo sapiens (human): 2294Help
Entry
2294              CDS       T01001                                 

Gene name
FOXF1, ACDMPV, FKHL5, FREAC1
Definition
(RefSeq) forkhead box F1
  KO
K09399  forkhead box protein F
Organism
hsa  Homo sapiens (human)
Disease
H00830  Alveolar capillary dysplasia with misalignment of pulmonary veins
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2294 (FOXF1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    2294 (FOXF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 2294
NCBI-ProteinID: NP_001442
OMIM: 601089
HGNC: 3809
Ensembl: ENSG00000103241
Vega: OTTHUMG00000137651
Pharos: Q12946(Tbio)
UniProt: Q12946
Position
16q24.1
AA seq 379 aa AA seqDB search
MSSAPEKQQPPHGGGGGGGGGGGAAMDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMA
IQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGH
YWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLS
CPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHD
SSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPL
SGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAG
GGSYYHQQVTYQDIKPCVM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggcgcccgagaagcagcagccaccgcacggcggcggcggcggcggcggcggg
ggaggcggcgcggccatggaccccgcgtcgtccggcccgtccaaggccaagaagaccaac
gccggcatccggcgcccggagaagccgccctattcctacatcgcgctcatcgtcatggcc
atccagagttcacccaccaagcgcctgacgctgagcgagatctaccagttcctgcagagc
cgcttccccttcttccggggctcctaccagggctggaagaactccgtgcgccacaacctc
tcgctcaacgagtgcttcatcaagctacccaagggccttgggcggcccggcaagggccac
tactggaccatcgacccggccagcgagttcatgttcgaggagggctcctttcggcggcgg
ccgcgcggcttccgaaggaaatgccaggcgctcaagcccatgtacagcatgatgaacggg
ctcggcttcaaccacctcccggacacctacggcttccagggctcggccggcggcctctcg
tgcccgcccaacagcctggcgctggagggcggcctgggcatgatgaacggccacttgccg
ggcaacgtggacggcatggccctgcccagccactcggtgccccacctgccttccaacggc
ggccactcgtacatgggcggctgcggcggcgcggcggccggcgagtacccgcaccacgac
agctcggtgcccgcctccccgctgctgcccaccggcgccggtggggtcatggagccgcac
gccgtctactcgggctcggcggcggcctggccgccctcggcgtccgcggcgctcaacagc
ggcgcctcttatatcaagcagcagcccctgtccccctgtaaccccgcggccaaccccctg
tccggcagcctctccacgcactccctggagcagccgtatctgcaccagaacagccacaac
gccccagccgagctgcaaggcatcccgcggtatcactcgcagtcgcccagcatgtgtgac
cgaaaggagtttgtcttctctttcaacgccatggcgtcctcttccatgcactcggccggc
gggggctcctactaccaccagcaggtcacctaccaagacatcaagccttgcgtgatgtga

DBGET integrated database retrieval system