KEGG   Homo sapiens (human): 22944
Entry
22944             CDS       T01001                                 

Gene name
KIN, BTCD, KIN17, Rts2
Definition
(RefSeq) Kin17 DNA and RNA binding protein
  KO
K13102  DNA/RNA-binding protein KIN17
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    22944 (KIN)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   Other processing factors
    22944 (KIN)
SSDB
Motif
Pfam: Kin17_mid KN17_SH3 KOW SecM DDHD zf-met zf-C2H2_jaz DUF808 zf-C2H2_2
Other DBs
NCBI-GeneID: 22944
NCBI-ProteinID: NP_036443
OMIM: 601720
HGNC: 6327
Ensembl: ENSG00000151657
Vega: OTTHUMG00000017634
Pharos: O60870(Tbio)
UniProt: O60870
Structure
PDB: 
2CKK 2V1N

Position
10p14
AA seq 393 aa
MGKSDFLTPKAIANRIKSKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQLLLASEN
PQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTK
WLGREGLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKKQDLDDEEKTAKFIEEQVRRG
LEGKEQEVPTFTELSRENDEEKVTFNLSKGACSSSGATSSKSSTLGPSALKTIGSSASVK
RKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDYWLQPEIIVKIITKKLGEKYHK
KKAIVKEVIDKYTAVVKMIDSGDKLKLDQTHLETVIPAPGKRILVLNGGYRGNEGTLESI
NEKTFSATIVIETGPLKGRRVEGIQYEDISKLA
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggggaagtcggattttcttactcccaaggctatcgccaacaggatcaagtccaagggg
ctgcagaagctacgctggtattgccagatgtgccagaagcagtgccgggacgagaatggc
tttaagtgtcattgtatgtccgaatctcatcagagacaactattgctggcttcagaaaat
cctcagcagtttatggattatttttcagaggaattccgaaatgactttctagaacttctc
aggagacgctttggcactaaaagggtccacaacaacattgtctacaacgaatacatcagc
caccgagagcacatccacatgaatgccactcagtgggaaactctgactgattttactaag
tggctgggcagagaaggcttgtgcaaagtggacgagacaccaaaaggctggtatattcag
tacatagacagggacccagaaactatccgccggcaactggaactggagaaaaagaaaaag
caggaccttgatgatgaagaaaaaactgccaaatttattgaagagcaagtgagaagaggc
ctggaagggaaggaacaggaggtccctacttttacggaattaagcagagaaaatgatgaa
gagaaagtcacgtttaatttgagtaaaggagcatgtagctcatccggagcaacatcttcc
aagtcaagtactctgggaccgagtgcactgaagacgataggaagttcagcatcagtgaaa
cgaaaagaatcttcccagagctcaactcagtctaaagaaaagaagaaaaagaaatctgca
ctggatgaaatcatggagattgaagaggaaaagaaaagaactgcccgaacagactactgg
ctacagcctgaaattattgtgaaaattataaccaagaaactgggagagaaatatcataag
aaaaaggctattgttaaggaagtaattgacaaatatacagctgttgtgaagatgattgat
tctggagacaagctgaaacttgaccagactcatttagagacagtaattccagcaccagga
aaaagaattctagttttaaatggaggctacagaggaaatgaaggtaccctagaatccatc
aatgagaagactttttcagctactatcgtcattgaaactggccctttaaaaggacgcaga
gttgaaggaattcaatatgaagacatttctaaacttgcctga

DBGET integrated database retrieval system