KEGG   Homo sapiens (human): 2295
Entry
2295              CDS       T01001                                 
Symbol
FOXF2, FKHL6, FREAC-2, FREAC2
Name
(RefSeq) forkhead box F2
  KO
K09399  forkhead box protein F
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2295 (FOXF2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    2295 (FOXF2)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 2295
NCBI-ProteinID: NP_001443
OMIM: 603250
HGNC: 3810
Ensembl: ENSG00000137273
Pharos: Q12947(Tbio)
UniProt: Q12947
Position
6:1389576..1395603
AA seq 444 aa
MTTEGGPPPAPLRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSS
SSSNSASAPSAACKSAGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVMAIQSSPSKR
LTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPAS
EFMFEEGSFRRRPRGFRRKCQALKPMYHRVVSGLGFGASLLPQGFDFQAPPSAPLGCHSQ
GGYGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNPGSTYMASCPVPAGPGGVGAA
GGGGGGDYGPDSSSSPVPSSPAMASAIECHSPYTSPAAHWSSPGASPYLKQPPALTPSSN
PAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFH
PSASGSYYHHHHQSVCQDIKPCVM
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgaccaccgagggcgggccgccgccggccccgctccgccgcgcgtgcagcccggtcccc
ggcgcgctccaggccgccctgatgagcccgccgcccgccgccgccgccgccgccgccgcc
gccccggagaccacctcctcctcctcgtcgtcgtcctccgcctcctgcgcctcgtcctcg
tcctcctccaattcggccagcgccccctcggctgcctgcaagagcgcgggcggcggcggc
gcgggcgccgggagcgggggcgccaagaaggcgagctcggggctgcggcggcccgagaag
ccgccctactcgtacatcgcgctcatcgtcatggccatccagagctcgcccagcaagcgc
ctgacgctcagcgagatctaccagttcctgcaggcgcgcttccccttcttccgcggcgcc
taccagggctggaagaactcggtgcgccacaatctctcgctcaacgagtgcttcatcaag
ctgcctaagggcctcgggcggcccggcaagggccactactggaccatcgacccggccagc
gagttcatgttcgaggagggctcgttccgccgccggccgcgcggcttcaggcggaagtgc
caggcgctcaagcccatgtaccaccgcgtggtgagcggcttgggcttcggggcgtcgctg
ctgccccagggcttcgacttccaggcgcccccgtcggcgccgctcggctgccacagccag
ggcggctacggcggcctcgacatgatgcccgcgggctacgacgccggcgcgggcgccccc
agccacgcgcaccctcaccaccaccaccaccaccacgtcccgcacatgtcgcccaacccg
ggttccacctacatggccagctgcccggtgcccgcgggacccgggggcgtcggtgcggcc
gggggcggcggcggcggcgactacgggccggacagcagcagcagcccggtaccctcgtcc
ccggccatggcgagcgccatcgaatgccactcgccctacacgagccctgcggcgcactgg
agctcgcctggcgcctcgccttacctcaagcagccgcctgccctgacgcccagcagcaac
cccgccgcctcggcaggcctgcactccagcatgtcctcctactcgctggagcagagctac
ttgcaccagaacgctcgcgaggacctctcagtgggactgccccgttaccagcatcactct
actccagtgtgtgacagaaaagatttcgtcctcaacttcaatgggatttcttctttccat
ccctcagctagcgggtcgtattatcaccatcaccaccagagcgtctgtcaggatattaag
ccctgcgtcatgtga

DBGET integrated database retrieval system