KEGG   Homo sapiens (human): 22974Help
Entry
22974             CDS       T01001                                 

Gene name
TPX2, C20orf1, C20orf2, DIL-2, DIL2, FLS353, GD:C20orf1, HCA519, HCTP4, REPP86, p100
Definition
(RefSeq) TPX2, microtubule nucleation factor
  KO
K16812  targeting protein for Xklp2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    22974 (TPX2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    22974 (TPX2)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     22974 (TPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPX2_importin Aurora-A_bind TPX2
Motif
Other DBs
NCBI-GeneID: 22974
NCBI-ProteinID: NP_036244
OMIM: 605917
HGNC: 1249
Ensembl: ENSG00000088325
Vega: OTTHUMG00000032190
Pharos: Q9ULW0(Tbio)
UniProt: Q9ULW0 Q643R0
Structure
PDB: 

Position
20q11.21
AA seq 747 aa AA seqDB search
MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTP
LRKANLQQAIVTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRR
SLRLSAQKDLEQKEKHHVKMKAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTA
EKNASSPEKAKGRHTVPCMPPAKQKFLKSTEEQELEKSMKMQQEVVEMRKKNEEFKKLAL
AGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKG
CTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDDINLLPSKSSV
TKICRDPQTPVLQTKHRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPK
KPPVKPPTEPIGFDLEIEKRIQERESKKKTEDEHFEFHSRPCPTKILEDVVGVPEKKVLP
ITVPKSPAFALKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKPQIPEARTVEICPFSF
DSRDKERQLQKEKKIKELQKGEVPKFKALPLPHFDTINLPEKKVKNVTQIEPFCLETDRR
GALKAQTWKHQLEEELRQQKEAACFKARPNTVISQEPFVPKKEKKSVAEGLSGSLVQEPF
QLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQKKEELARLRRELVHKANPIRK
YQGLEIKSSDQPLTVPVSPKFSTRFHC
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagttaaaagctcttattcctatgatgccccctcggatttcatcaatttttca
tccttggatgatgaaggagatactcaaaacatagattcatggtttgaggagaaggccaat
ttggagaataagttactggggaagaatggaactggagggctttttcagggcaaaactcct
ttgagaaaggctaatcttcagcaagctattgtcacacctttgaaaccagttgacaacact
tactacaaagaggcagaaaaagaaaatcttgtggaacaatccattccgtcaaatgcttgt
tcttccctggaagttgaggcagccatatcaagaaaaactccagcccagcctcagagaaga
tctcttaggctttctgctcagaaggatttggaacagaaagaaaagcatcatgtaaaaatg
aaagccaagagatgtgccactcctgtaatcatcgatgaaattctaccctctaagaaaatg
aaagtttctaacaacaaaaagaagccagaggaagaaggcagtgctcatcaagatactgct
gaaaagaatgcatcttccccagagaaagccaagggtagacatactgtgccttgtatgcca
cctgcaaagcagaagtttctaaaaagtactgaggagcaagagctggagaagagtatgaaa
atgcagcaagaggtggtggagatgcggaaaaagaatgaagaattcaagaaacttgctctg
gctggaatagggcaacctgtgaagaaatcagtgagccaggtcaccaaatcagttgacttc
cacttccgcacagatgagcgaatcaaacaacatcctaagaaccaggaggaatataaggaa
gtgaactttacatctgaactacgaaagcatccttcatctcctgcccgagtgactaaggga
tgtaccattgttaagcctttcaacctgtcccaaggaaagaaaagaacatttgatgaaaca
gtttctacatatgtgccccttgcacagcaagttgaagacttccataaacgaacccctaac
agatatcatttgaggagcaagaaggatgatattaacctgttaccctccaaatcttctgtg
accaagatttgcagagacccacagactcctgtactgcaaaccaaacaccgtgcacgggct
gtgacctgcaaaagtacagcagagctggaggctgaggagctcgagaaattgcaacaatac
aaattcaaagcacgtgaacttgatcccagaatacttgaaggtgggcccatcttgcccaag
aaaccacctgtgaaaccacccaccgagcctattggctttgatttggaaattgagaaaaga
atccaggagcgagaatcaaagaagaaaacagaggatgaacactttgaatttcattccaga
ccttgccctactaagattttggaagatgttgtgggtgttcctgaaaagaaggtacttcca
atcaccgtccccaagtcaccagcctttgcattgaagaacagaattcgaatgcccaccaaa
gaagatgaggaagaggacgaaccggtagtgataaaagctcaacctgtgccacattatggg
gtgccttttaagccccaaatcccagaggcaagaactgtggaaatatgccctttctcgttt
gattctcgagacaaagaacgtcagttacagaaggagaagaaaataaaagaactgcagaaa
ggggaggtgcccaagttcaaggcacttcccttgcctcattttgacaccattaacctgcca
gagaagaaggtaaagaatgtgacccagattgaacctttctgcttggagactgacagaaga
ggtgctctgaaggcacagacttggaagcaccagctggaagaagaactgagacagcagaaa
gaagcagcttgtttcaaggctcgtccaaacaccgtcatctctcaggagccctttgttccc
aagaaagagaagaaatcagttgctgagggcctttctggttctctagttcaggaacctttt
cagctggctactgagaagagagccaaagagcggcaggagctggagaagagaatggctgag
gtagaagcccagaaagcccagcagttggaggaggccagactacaggaggaagagcagaaa
aaagaggagctggccaggctacggagagaactggtgcataaggcaaatccaatacgcaag
taccagggtctggagataaagtcaagtgaccagcctctgactgtgcctgtatctcccaaa
ttctccactcgattccactgctaa

DBGET integrated database retrieval system