KEGG   Homo sapiens (human): 22978
Entry
22978             CDS       T01001                                 
Symbol
NT5C2, GMP, NT5B, PNT5, SPG45, SPG65, cN-II
Name
(RefSeq) 5'-nucleotidase, cytosolic II
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
hsa01232  Nucleotide metabolism
Module
hsa_M00958  Adenine ribonucleotide degradation, AMP => Urate
hsa_M00959  Guanine ribonucleotide degradation, GMP => Urate
Network
nt06027  Purine salvage pathway
  Element
N01418  Purine salvage pathway, adenine to AMP
N01421  Purine salvage pathway, hypoxanthine/guanine to IMP/GMP
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    22978 (NT5C2)
   00240 Pyrimidine metabolism
    22978 (NT5C2)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    22978 (NT5C2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     22978 (NT5C2)
SSDB
Motif
Pfam: 5_nucleotid
Other DBs
NCBI-GeneID: 22978
NCBI-ProteinID: NP_001127845
OMIM: 600417
HGNC: 8022
Ensembl: ENSG00000076685
UniProt: P49902 A0A384MED8 A8K6K2
Position
10:complement(103088017..103193272)
AA seq 561 aa
MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVY
KSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLV
CAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTS
CETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKYVVKDGKLPLLLSRMK
EVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGT
VLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKS
KKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ
RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAA
HVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLA
PQEITHCHDEDDDEEEEEEEE
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgtcaacctcctggagtgatcggttacagaatgcagcagatatgcctgctaacatggat
aagcatgccctgaaaaagtatcgtcgagaagcctatcatcgggtgtttgtgaaccgaagt
ttagcaatggaaaagataaagtgttttggttttgatatggattatacccttgctgtgtac
aagtccccagagtatgagtcccttggttttgagcttactgtggagagattagtttctatt
ggctatccccaggagttgctcagctttgcttatgattctacattccctaccaggggactt
gtctttgacacactgtatggaaatcttttgaaagtcgatgcctatggaaacctcttggtc
tgtgcacatggatttaactttataaggggaccagaaactagagaacagtatccaaataaa
tttatccagcgagatgatactgaaagattttacattctgaacacactattcaacctacca
gagacctacctgttggcctgcctagtagatttttttactaattgtcccagatataccagt
tgtgaaacaggatttaaagatggggacctcttcatgtcctaccggagtatgttccaggat
gtaagagatgctgttgactgggttcattacaagggctcccttaaggaaaagacagttgaa
aatcttgagaagtatgtagtcaaagatggaaaactgcctttgcttctgagccggatgaag
gaagtagggaaagtatttcttgctaccaacagtgactataaatatacagataaaattatg
acttacctgtttgacttcccacatggccccaagcctgggagctcccatcgaccatggcag
tcctactttgacttgatcttggtggatgcacggaaaccactcttttttggagaaggcaca
gtactgcgtcaggtggatactaaaactggcaagctgaaaattggtacctacacagggccc
ctacagcatggtatcgtctactcaggaggttcttctgatacgatctgtgacctgttggga
gccaagggaaaagacattttgtatattggagatcacatttttggggacattttaaaatca
aagaaacggcaagggtggcgaacttttttggtgattcctgaactcgcacaggagctacat
gtctggactgacaagagttcacttttcgaagaacttcagagcttggatattttcttggct
gaactctacaagcatcttgacagcagtagcaatgagcgtccagacatcagttccatccag
agacgtattaagaaagtaactcatgacatggacatgtgctatgggatgatgggaagcctg
tttcgcagtggctcccggcagaccctttttgccagtcaagtgatgcgttatgctgacctc
tatgcagcatctttcatcaacctgctgtattaccctttcagctacctcttcagggctgcc
catgtcttgatgcctcatgaatcaacggtggagcacacacacgtagatatcaatgagatg
gagtctcctcttgccacccggaaccgcacatcagtggatttcaaagacactgactacaag
cggcaccagctgacacggtcaattagtgagattaaacctcccaacctcttcccactggcc
ccccaggaaattacacactgccatgacgaagatgatgatgaagaggaggaggaggaggaa
gaataa

DBGET integrated database retrieval system