KEGG   Homo sapiens (human): 22981Help
Entry
22981             CDS       T01001                                 

Gene name
NINL, NLP
Definition
(RefSeq) ninein like
  KO
K16477  ninein-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    22981 (NINL)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    22981 (NINL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 FAM184 PD40
Motif
Other DBs
NCBI-GeneID: 22981
NCBI-ProteinID: NP_079452
OMIM: 609580
HGNC: 29163
Ensembl: ENSG00000101004
Vega: OTTHUMG00000032127
Pharos: Q9Y2I6(Tbio)
UniProt: Q9Y2I6
Position
20p11.21
AA seq 1382 aa AA seqDB search
MDEEENHYVSQLREVYSSCDTTGTGFLDRQELTQLCLKLHLEQQLPVLLQTLLGNDHFAR
VNFEEFKEGFVAVLSSNAGVRPSDEDSSSLESAASSAIPPKYVNGSKWYGRRSRPELCDA
ATEARRVPEQQTQASLKSHLWRSASLESVESPKSDEEAESTKEAQNELFEAQGQLQTWDS
EDFGSPQKSCSPSFDTPESQIRGVWEELGVGSSGHLSEQELAVVCQSVGLQGLEKEELED
LFNKLDQDGDGKVSLEEFQLGLFSHEPALLLESSTRVKPSKAWSHYQVPEESGCHTTTTS
SLVSLCSSLRLFSSIDDGSGFAFPDQVLAMWTQEGIQNGREILQSLDFSVDEKVNLLELT
WALDNELMTVDSAVQQAALACYHQELSYQQGQVEQLARERDKARQDLERAEKRNLEFVKE
MDDCHSTLEQLTEKKIKHLEQGYRERLSLLRSEVEAERELFWEQAHRQRAALEWDVGRLQ
AEEAGLREKLTLALKENSRLQKEIVEVVEKLSDSERLALKLQKDLEFVLKDKLEPQSAEL
LAQEERFAAVLKEYELKCRDLQDRNDELQAELEGLWARLPKNRHSPSWSPDGRRRQLPGL
GPAGISFLGNSAPVSIETELMMEQVKEHYQDLRTQLETKVNYYEREIAALKRNFEKERKD
MEQARRREVSVLEGQKADLEELHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALC
GLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLE
LERALKLQPCASEKRAQMCVSLALEEEELELARGKRVDGPSLEAEMQALPKDGLVAGSGQ
EGTRGLLPLRPGCGERPLAWLAPGDGRESEEAAGAGPRRRQAQDTEATQSPAPAPAPASH
GPSERWSRMQPCGVDGDIVPKEPEPFGASAAGLEQPGARELPLLGTERDASQTQPRMWEP
PLRPAASCRGQAERLQAIQEERARSWSRGTQEQASEQQARAEGALEPGCHKHSVEVARRG
SLPSHLQLADPQGSWQEQLAAPEEGETKIALEREKDDMETKLLHLEDVVRALEKHVDLRE
NDRLEFHRLSEENTLLKNDLGRVRQELEAAESTHDAQRKEIEVLKKDKEKACSEMEVLNR
QNQNYKDQLSQLNVRVLQLGQEASTHQAQNEEHRVTIQMLTQSLEEVVRSGQQQSDQIQK
LRVELECLNQEHQSLQLPWSELTQTLEESQDQVQGAHLRLRQAQAQHLQEVRLVPQDRVA
ELHRLLSLQGEQARRRLDAQREEHEKQLKATEERVEEAEMILKNMEMLLQEKVDKLKEQF
EKNTKSDLLLKELYVENAHLVRALQATEEKQRGAEKQSRLLEEKVRALNKLVSRIAPAAL
SV
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaagagaaccactatgtctcgcagctcagggaagtctacagcagctgcgac
accacggggactggctttctggaccgccaggagctgacccagctctgccttaagcttcac
ctggagcagcagctgcccgtcctcctgcagacgcttctcggaaacgaccatttcgccagg
gttaactttgaggaatttaaggaaggttttgtggctgtgttgtcttcaaatgctggtgtt
cgcccctcagatgaagacagtagttctttggaatcagctgcctccagtgccatccctcca
aagtatgtgaatggttctaagtggtatggccgtcggagccggcctgagctatgtgacgct
gccacagaagccagacgcgtgccggagcagcaaacccaggccagcctgaaaagtcacctc
tggcgctcagcgtctctggagagcgtggagagtcccaagtcagatgaagaggccgagagc
actaaagaagctcagaatgaattatttgaagcacaaggacagctgcagacctgggattct
gaggactttgggagcccccagaagtcctgcagcccctcctttgacaccccagagagccag
atccggggcgtgtgggaagagctgggggtgggcagcagcggacacctgagcgagcaggag
ctggctgtggtctgccagagcgtcgggctccagggactcgagaaagaggaactcgaagac
ctgtttaacaaactggatcaagacggagacggcaaagtgagtcttgaggaattccagctt
ggcctcttcagtcatgagcccgcgctacttctagagtcttccactcgggttaaaccgagc
aaggcttggtctcattaccaggtcccagaggagagcggctgccacaccaccacaacctca
tccctcgtgtccctgtgctccagcctgcgcctcttctccagcattgacgatggttctggc
ttcgcttttcctgatcaggtcctggccatgtggacccaggaggggattcagaatggcagg
gagatcttgcagagcctggacttcagcgtggacgagaaggtgaaccttctggagctgacc
tgggcccttgacaacgagctcatgacagtggacagtgccgtccagcaggcagccctggcc
tgctaccaccaggagctgagctaccagcaagggcaggtggagcagctggcaagggagcgt
gacaaggcaaggcaggacctggagagggccgagaagaggaacctggagtttgtgaaagag
atggacgactgccactccaccctggagcagctcacggagaagaaaatcaagcatctggag
caggggtaccgggaaaggctgagcctcctgcggtctgaggtggaggcggagcgagagctg
ttctgggagcaggcccacaggcagagggccgcgctggagtgggacgtggggcgcctgcag
gctgaggaggctggcctccgcgagaagctgaccctggccctgaaggaaaacagtcgccta
cagaaggagattgtggaagtggtggaaaagctttcggattcggagaggctggccctgaag
ctgcagaaggacctggagtttgtgctgaaggacaagctggagccacagagtgcagagctc
ctggcccaggaggagcggttcgcagcagtcctgaaggaatacgagctcaagtgccgggac
ctgcaggaccgcaacgatgagctgcaagctgagctggaaggcctgtgggcgcggctgccc
aagaaccggcacagcccctcatggagcccggatgggcgcagacggcagctccctggactc
ggcccagcaggcatttcattcctgggtaattctgctccagtgagtatagaaacggagctg
atgatggagcaggtaaaggagcattaccaagacctcaggacccagctggagaccaaggta
aattactacgaaagggaaattgcggcactgaaaaggaactttgagaaggagaggaaggac
atggagcaggctcgcaggcgcgaggtcagcgtgctggagggtcagaaggccgacctggag
gagctccacgagaagtctcaggaggtcatctggggcctgcaggagcagctgcaggacaca
gcccgcggccccgagcctgagcagatgggcctggcaccctgctgcacccaggcactgtgt
ggcctggccctgcggcatcacagccacctgcagcagatcaggagagaggctgaggcggag
ctgagtggagagctgtcggggctgggagccctgcccgctcgcagagacctgaccttggag
ctggaggagccgccgcagggacccctgccacgcgggagccagaggtcggagcagctggag
ctggagagggcactgaagctgcagccctgtgcgagcgagaagcgcgcccagatgtgcgta
tcgttggccctcgaggaggaggagttggagcttgcccgcgggaagcgagtggacgggccc
tccctggaagcagagatgcaggccctgccgaaagatgggctggtggcaggaagtggccag
gagggcacacgtggcctcctaccactgcgtccgggctgtggggagcggccactggcctgg
ctggccccaggtgatggcagagagtctgaggaggcggcaggagccgggcctcgccgcagg
caagcccaggacacagaagctacgcagagcccggcccccgcccctgccccggcatcccac
ggcccctcagagaggtggtcacgcatgcagccctgtggagtggatggggatattgtccca
aaggagccagagcctttcggcgcgagcgcagcggggctggagcagcctggagcccgggag
ctgcctctgctgggaacagagagagacgcctcgcaaacccagccacggatgtgggagcca
cccctgaggccggccgcttcgtgcaggggacaggctgagaggctacaggccattcaggaa
gagcgagcacgaagctggagcaggggcacccaggagcaggcctcggagcagcaggcccgg
gccgagggcgccctggagcctgggtgtcacaagcacagtgtggaggttgccaggagaggg
tccttgccatcccacctccagctcgcagacccgcagggttcctggcaggagcagcttgct
gccccagaagagggggagaccaaaatagcgctggagagagagaaggatgacatggaaacc
aaacttctacatctggaagacgtcgtccgggctctggagaaacatgtagatttgagagag
aacgacagactggagttccatagactttctgaagaaaacactttgttgaaaaacgatctg
ggaagggttcggcaagagcttgaagctgcagaaagtactcacgatgcacagaggaaggaa
attgaggttttaaagaaagacaaggaaaaggcctgctctgagatggaggtgctcaacaga
cagaatcagaactacaaggatcaattatcccagctcaatgtcagggttcttcaactggga
caggaggcttctacccaccaggcccaaaacgaggagcatcgtgtgaccattcagatgtta
acacagagcctggaggaggtggttcgcagtgggcagcagcagagtgaccaaatccaaaaa
cttagagttgaacttgaatgcctgaatcaggaacatcagagcctgcagctgccatggtca
gagctgacccagacccttgaggaaagtcaagaccaggtgcagggagctcacctgaggctg
aggcaggcccaggcccagcacttgcaggaggtccggctggtgccccaggaccgtgtggcc
gagctgcatcgcctgctcagccttcagggagagcaggccaggaggcgcctggatgcacag
cgggaagaacatgagaaacagctgaaagccacagaagagcgggtggaagaggcggagatg
attctgaagaatatggaaatgctcctccaagagaaagtggataagctgaaggagcagttt
gaaaagaacacgaagtccgacctgctgctgaaggagctgtacgtggagaacgcccacctg
gtgagagcacttcaggccaccgaggagaagcagcgaggcgccgagaaacaaagccgcctc
ttggaagaaaaagttcgcgctctcaacaaactcgtcagtaggattgcccccgcagccctc
tctgtgtaa

DBGET integrated database retrieval system