KEGG   Homo sapiens (human): 22983Help
Entry
22983             CDS       T01001                                 

Gene name
MAST1, MCCCHCM, SAST
Definition
(RefSeq) microtubule associated serine/threonine kinase 1
  KO
K08789  microtubule-associated serine/threonine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    22983 (MAST1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     22983 (MAST1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  MAST family [OT]
   22983 (MAST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1908 Pkinase Pkinase_Tyr PDZ_6 PDZ PDZ_2 APH Kinase-like Tricorn_PDZ Pkinase_fungal RIO1 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 22983
NCBI-ProteinID: NP_055790
OMIM: 612256
HGNC: 19034
Ensembl: ENSG00000105613
Vega: OTTHUMG00000180514
Pharos: Q9Y2H9(Tchem)
UniProt: Q9Y2H9
Structure
PDB: 

Position
19p13.13
AA seq 1570 aa AA seqDB search
MSDSLWTALSNFSMPSFPGGSMFRRTKSCRTSNRKSLILTSTSPTLPRPHSPLPGHLGSS
PLDSPRNFSPNTPAHFSFASSRRADGRRWSLASLPSSGYGTNTPSSTVSSSCSSQERLHQ
LPYQPTVDELHFLSKHFGSTESITDEDGGRRSPAVRPRSRSLSPGRSPSSYDNEIVMMNH
VYKERFPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLI
TTVYFYELQENLEKLLQDAYERSESLEVAFVTQLVKKLLIIISRPARLLECLEFNPEEFY
HLLEAAEGHAKEGHLVKTDIPRYIIRQLGLTRDPFPDVVHLEEQDSGGSNTPEQDDLSEG
RSSKAKKPPGENDFDTIKLISNGAYGAVYLVRHRDTRQRFAMKKINKQNLILRNQIQQAF
VERDILTFAENPFVVGMFCSFETRRHLCMVMEYVEGGDCATLLKNIGALPVEMARMYFAE
TVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKMGLMSLTTNLYEGHIEKDAR
EFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVI
SDDILWPEGDEALPTEAQLLISSLLQTNPLVRLGAGGAFEVKQHSFFRDLDWTGLLRQKA
EFIPHLESEDDTSYFDTRSDRYHHVNSYDEDDTTEEEPVEIRQFSSCSPRFSKVYSSMEQ
LSQHEPKTPVAAAGSSKREPSTKGPEEKVAGKREGLGGLTLREKTWRGGSPEIKRFSASE
ASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDEARLRRPPRPSSDPAGSLDARAPKE
ETQGEGTSSAGDSEATDRPRPGDLCPPSKDGDASGPRATNDLVLRRARHQQMSGDVAVEK
RPSRTGGKVIKSASATALSVMIPAVDPHGSSPLASPMSPRSLSSNPSSRDSSPSRDYSPA
VSGLRSPITIQRSGKKYGFTLRAIRVYMGDTDVYSVHHIVWHVEEGGPAQEAGLCAGDLI
THVNGEPVHGMVHPEVVELILKSGNKVAVTTTPFENTSIRIGPARRSSYKAKMARRNKRP
SAKEGQESKKRSSLFRKITKQSNLLHTSRSLSSLNRSLSSSDSLPGSPTHGLPARSPTHS
YRSTPDSAYLGASSQSSSPASSTPNSPASSASHHIRPSTLHGLSPKLHRQYRSARCKSAG
NIPLSPLAHTPSPTQASPPPLPGHTVGSSHTTQSFPAKLHSSPPVVRPRPKSAEPPRSPL
LKRVQSAEKLGASLSADKKGALRKHSLEVGHPDFRKDFHGELALHSLAESDGETPPVEGL
GAPRQVAVRRLGRQESPLSLGADPLLPEGASRPPVSSKEKESPGGAEACTPPRATTPGGR
TLERDVGCTRHQSVQTEDGTGGMARAVAKAALSPVQEHETGRRSSSGEAGTPLVPIVVEP
ARPGAKAVVPQPLGADSKGLQEPAPLAPSVPEAPRGRERWVLEVVEERTTLSGPRSKPAS
PKLSPEPQTPSLAPAKCSAPSSAVTPVPPASLLGSGTKPQVGLTSRCPAEAVPPAGLTKK
GVSSPAPPGP
NT seq 4713 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactctctctggaccgcgctttctaatttctcgatgccctccttccccggcggc
agtatgttccgccgcaccaagagctgccgcaccagtaatcggaaaagcctcatcctgacc
agcacttcacccacgctaccgagaccccactccccgctgccaggtcacctaggcagcagt
cccctggacagcccccgaaacttctcccccaacacccccgcccacttctcgtttgcctcc
tcccgaagggcggacggacgccggtggtctctggcctcgctcccttcatctggctatggc
accaacacgcccagttccaccgtctcgtcctcctgctcctcccaggagcgccttcaccag
ctgccctaccagcccacggtggacgagctccacttcctctccaaacacttcgggagcacc
gagagcatcacagacgaggatggtggccgtcgctccccagccgtgcggccccgctcacgg
agcctcagccccgggcgctccccctcctcctacgacaacgagatcgtgatgatgaatcac
gtctacaaggagaggttcccgaaggccactgcgcagatggaggagaagctgcgcgacttt
acccgcgcctacgaacccgacagcgttctgcctctggccgatggcgtgctcagcttcatc
caccaccagatcatcgagctggcccgggactgcctgaccaagtcccgtgacggcctcatc
accacggtctacttctatgaattgcaggagaacctggagaagctccttcaagacgcctat
gaacgctctgagagcttggaggtggccttcgttactcagctggtgaagaagttgcttatt
atcatctcacgccctgcgaggctgctggagtgcctggaattcaaccccgaggagttctac
cacctgctggaggcggccgaaggacacgccaaggagggccaccttgtgaagacggacatc
ccccgctacatcatccgccagctgggcctcacccgtgacccctttccagatgtggtgcat
ctggaggaacaggacagtggtggttccaacacccctgagcaagacgatctctctgagggc
cgcagcagcaaggccaagaaaccgccgggggagaatgacttcgataccatcaagctcata
agcaacggtgcctacggcgctgtctacctggtgcggcaccgcgacacgcggcagcgcttt
gccatgaaaaagatcaacaagcagaacttgatcctccgcaaccagatccagcaggccttt
gtggagcgcgatatcctcaccttcgccgagaacccgtttgtggtcggcatgttctgctcc
tttgagactcggcgccacctctgcatggtcatggaatatgtggaaggcggcgactgtgcc
accctgctgaagaatattggagcgctgcccgtagagatggcccgcatgtactttgctgag
acggtgctagccctggagtatttgcacaactatggcatcgtgcaccgcgacctcaagcct
gacaacctccttatcacctccatgggtcacatcaagctcacagatttcggcctctccaag
atggggctcatgagcctcaccaccaacttatatgaaggccacatcgagaaggacgcccga
gagttcctggacaaacaggtgtgtgggaccccagagtacatcgcgcccgaggtcatcctg
cgtcaaggctacggcaagccagtggactggtgggctatggggatcatcctctacgagttc
ctggtgggctgtgtgcccttcttcggagacacaccagaggagctatttggacaggtcatc
agtgatgacatcctgtggcccgagggggatgaggccctacctacggaggcccaactcctc
atatccagcctcctgcagaccaaccctctggtcaggcttggggcaggcggcgcttttgag
gtgaagcagcacagtttctttcgagacctggactggacagggctgctgaggcagaaggcc
gagttcatcccccacctagagtcggaagatgacactagctactttgacacccgctcagac
aggtatcaccacgtgaactcctatgacgaggatgacacgacggaggaggagcccgtggaa
atccgccagttctcttcctgctctccgcgcttcagcaaggtgtatagcagcatggagcag
ctgtcgcagcacgagcccaagaccccagtagcagctgcagggagcagcaagcgggagccg
agcaccaagggccccgaggagaaggtggccggcaagcgggaggggctgggcggcctgacc
ctgcgtgagaagacctggagagggggctctccggagatcaagcgattctccgcgtccgag
gccagtttcctggagggagaggccagtccccctttgggcgcccgccgccgtttctcggcg
ctgctggagcccagccgcttcagcgccccccaagaggacgaggatgaggcccggctgcgc
aggcctccccggcccagctccgaccccgcgggatccctggatgcacgggcccccaaagag
gagactcaaggggaaggcacctccagcgccggggactccgaggccactgaccgtccacgc
ccaggtgacctctgcccaccctcgaaggatggggatgcatcaggcccaagggctaccaat
gacttggttctgcgccgggcgcggcaccagcagatgtcaggggatgtggcagtagagaag
aggccttctcgaactgggggcaaagtcatcaaatcagcctcagccactgccttatctgtc
atgattcctgcagtggacccacatggaagttcaccccttgctagtcccatgtctccacga
tctctgtcctccaacccatcctcacgggactcctcacccagccgggactactcaccagct
gtcagtgggctccgctcccccatcaccatccagcgctcgggcaagaagtatggcttcaca
ctgcgtgccatccgtgtctacatgggtgacacggatgtctatagtgtccaccacattgtc
tggcatgtggaggaaggaggcccagcccaggaggcaggactctgtgctggggacctcatc
acccacgtgaatggggagcctgtgcatggcatggtgcatcctgaggtcgtggagctgatc
cttaagagtggcaacaaggtagcagtgaccacaacgcccttcgaaaatacctctatccgc
attggtcccgcaaggcgcagcagctacaaggctaaaatggctcggaggaacaagcgaccc
tccgccaaggagggccaggagagcaagaagcgcagctccctcttccggaagatcacgaag
cagtcgaacctgctgcatactagccgctcgctgtcgtcgctgaaccgctcgctgtcatcc
agcgatagtctcccgggctcgcctacgcacgggctgccggcgcgctcgcccacgcacagc
taccgctccacgcctgactccgcctacctaggcgcctcatcccagagcagctccccagcc
tcgagcacgcccaactcgcctgcgtcgtcggcgtcgcaccacattcggcccagcacgctg
cacggactgtcgccaaagctccatcgccagtaccgctctgcgcgatgcaagtcggccggc
aacatccctctatcgccgctggcacacacgccgtcccccacgcaggcgtcaccgccgcca
ctgccgggccacacggtgggcagctcgcacactactcagagcttcccggccaaactgcac
tcatcgcctcccgtcgtgcgcccgcgccccaagagtgccgagccccctcgctcgccgctc
ctcaagcgcgtgcagtcggccgagaagctgggagcctctttgagtgcggacaagaagggc
gcgctgcgcaaacacagcctcgaggtgggccacccggatttccgcaaggacttccatggc
gagctggcgctgcatagccttgccgagtccgacggtgagacgcccccagtcgagggcctt
ggcgcgccccggcaggtcgccgtccgccgcctgggccgacaggagtcacctttgagcctg
ggcgcggacccgttgctgcccgagggtgcctccaggccaccagtgtcgagcaaggagaag
gaatccccggggggcgccgaggcgtgcaccccaccccgcgcgacgacccccggtggccgg
accctggagcgggacgtcggctgcacgcggcatcagagcgtgcagacggaggatggcact
ggcgggatggccagggctgtggccaaggcggcgctgagcccggtgcaggaacacgagaca
ggccggcgcagcagctctggcgaggcgggcacacccctggtacccattgtcgtagagcct
gcgcggcccggggctaaggctgtggtgcctcagcctctgggcgcggactccaaggggttg
caggaacccgcacccctggcgccttccgtgcccgaggccccccggggccgggagcgctgg
gtgttggaggtggtggaggagcgcaccacgctgagcggtcctcgctccaagcccgcctcc
ccaaagctctccccggagccccagacaccctccctagccccagcgaagtgcagtgcaccc
agcagtgcagtgaccccagtcccacccgcatccctcttgggctcaggcaccaagcctcaa
gtggggctgacctcccggtgccctgctgaagctgtgcccccagcaggcctgaccaaaaaa
ggagtgtccagtcccgcacccccgggaccatag

DBGET integrated database retrieval system