KEGG   Homo sapiens (human): 22984
Entry
22984             CDS       T01001                                 
Symbol
PDCD11, ALG-4, ALG4, NFBP, RRP5
Name
(RefSeq) programmed cell death 11
  KO
K14792  rRNA biogenesis protein RRP5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    22984 (PDCD11)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    22984 (PDCD11)
SSDB
Motif
Pfam: S1 Suf TPR_19 TPR_14 TPR_16 TPR_15 TPR_6 TPR_12 PPR TPR_7 TPR_2
Other DBs
NCBI-GeneID: 22984
NCBI-ProteinID: NP_055791
OMIM: 612333
HGNC: 13408
Ensembl: ENSG00000148843
Vega: OTTHUMG00000018988
Pharos: Q14690(Tdark)
UniProt: Q14690
Structure
Position
10:103396626..103446294
AA seq 1871 aa
MANLEESFPRGGTRKIHKPEKAFQQSVEQDNLFDISTEEGSTKRKKSQKGPAKTKKLKIE
KRESSKSAREKFEILSVESLCEGMRILGCVKEVNELELVISLPNGLQGFVQVTEICDAYT
KKLNEQVTQEQPLKDLLHLPELFSPGMLVRCVVSSLGITDRGKKSVKLSLNPKNVNRVLS
AEALKPGMLLTGTVSSLEDHGYLVDIGVDGTRAFLPLLKAQEYIRQKNKGAKLKVGQYLN
CIVEKVKGNGGVVSLSVGHSEVSTAIATEQQSWNLNNLLPGLVVKAQVQKVTPFGLTLNF
LTFFTGVVDFMHLDPKKAGTYFSNQAVRACILCVHPRTRVVHLSLRPIFLQPGRPLTRLS
CQNLGAVLDDVPVQGFFKKAGATFRLKDGVLAYARLSHLSDSKNVFNPEAFKPGNTHKCR
IIDYSQMDELALLSLRTSIIEAQYLRYHDIEPGAVVKGTVLTIKSYGMLVKVGEQMRGLV
PPMHLADILMKNPEKKYHIGDEVKCRVLLCDPEAKKLMMTLKKTLIESKLPVITCYADAK
PGLQTHGFIIRVKDYGCIVKFYNNVQGLVPKHELSTEYIPDPERVFYTGQVVKVVVLNCE
PSKERMLLSFKLSSDPEPKKEPAGHSQKKGKAINIGQLVDVKVLEKTKDGLEVAVLPHNI
RAFLPTSHLSDHVANGPLLHHWLQAGDILHRVLCLSQSEGRVLLCRKPALVSTVEGGQDP
KNFSEIHPGMLLIGFVKSIKDYGVFIQFPSGLSGLAPKAIMSDKFVTSTSDHFVEGQTVA
AKVTNVDEEKQRMLLSLRLSDCGLGDLAITSLLLLNQCLEELQGVRSLMSNRDSVLIQTL
AEMTPGMFLDLVVQEVLEDGSVVFSGGPVPDLVLKASRYHRAGQEVESGQKKKVVILNVD
LLKLEVHVSLHQDLVNRKARKLRKGSEHQAIVQHLEKSFAIASLVETGHLAAFSLTSHLN
DTFRFDSEKLQVGQGVSLTLKTTEPGVTGLLLAVEGPAAKRTMRPTQKDSETVDEDEEVD
PALTVGTIKKHTLSIGDMVTGTVKSIKPTHVVVTLEDGIIGCIHASHILDDVPEGTSPTT
KLKVGKTVTARVIGGRDMKTFKYLPISHPRFVRTIPELSVRPSELEDGHTALNTHSVSPM
EKIKQYQAGQTVTCFLKKYNVVKKWLEVEIAPDIRGRIPLLLTSLSFKVLKHPDKKFRVG
QALRATVVGPDSSKTLLCLSLTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSI
FHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSSRTNPETKSKVEDPEINSIQD
IKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTAR
VLRLNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEERKTEAEERDQKGEKKNQKRNE
KKNQKGQEEVEMPSKEKQQPQKPQAQKRGGRECRESGSEQERVSKKPKKAGLSEEDDSLV
DVYYREGKEEAEETNVLPKEKQTKPAEAPRLQLSSGFAWNVGLDSLTPALPPLAESSDSE
EDEKPHQATIKKSKKERELEKQKAEKELSRIEEALMDPGRQPESADDFDRLVLSSPNSSI
LWLQYMAFHLQATEIEKARAVAERALKTISFREEQEKLNVWVALLNLENMYGSQESLTKV
FERAVQYNEPLKVFLHLADIYAKSEKFQEAGELYNRMLKRFRQEKAVWIKYGAFLLRRSQ
AAASHRVLQRALECLPSKEHVDVIAKFAQLEFQLGDAERAKAIFENTLSTYPKRTDVWSV
YIDMTIKHGSQKDVRDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKAKALE
YVEAKSSVLED
NT seq 5616 nt   +upstreamnt  +downstreamnt
atggcaaacctggaagaaagcttcccccgaggaggtacaagaaagatccacaaaccagag
aaagctttccagcagtcagttgaacaagacaacttatttgatatttctactgaagaggga
tccaccaaaagaaaaaagagccagaaggggccagcaaaaacaaaaaagttgaaaatcgaa
aagagagaaagcagcaagtccgcaagagagaagtttgaaatccttagtgttgagtccctg
tgtgagggaatgcgtattttgggttgcgtgaaagaggtgaatgaactggaactggtgatt
agtctccccaatggcctccagggctttgtgcaagtcactgaaatctgtgatgcctacacc
aaaaagctgaatgagcaggtgacacaagaacaacctctgaaggacctacttcacttgcct
gaacttttctcacctggaatgctggtaagatgtgtggtgagcagtctgggcatcacagac
aggggcaagaagagtgtcaagctgtctctgaaccccaaaaatgtcaacagagtgctgagt
gctgaggccctgaagcctggcatgctacttacaggtaccgtatccagcctggaagaccat
ggctacctagtggacattggtgttgatgggaccagagcttttctgccactgctgaaagcc
caggagtacatcagacagaagaacaaaggtgctaaactaaaggtgggtcagtacctgaac
tgcattgttgaaaaggtgaaaggcaacggaggagttgttagtctgtctgttggtcactca
gaggtttctacggccattgctactgaacagcagagctggaaccttaataacttgctacca
ggactggtggtcaaagctcaggtacagaaggtgactccatttggccttacgctaaacttc
ctcacattcttcacgggcgtggttgactttatgcacctggatcccaagaaagctggaaca
tatttctcaaatcaggcagtgagggcctgcatcctttgcgtccatcctcgaaccagagtt
gtgcacctgagcctgcgccccatcttcctacagcctggacgcccactcacccgactctct
tgccagaaccttggagcagtgctggatgatgttcctgtccagggttttttcaaaaaggct
ggggccacctttaggctgaaggatggggttctggcctatgcccggctcagccatctctct
gattctaagaacgtcttcaatcctgaggccttcaagccagggaacactcacaagtgtaga
attattgactacagccaaatggatgaactggccttgctctctctacgaacgtctattatt
gaagctcagtaccttagatatcatgacatcgaacctggggcagtggtaaagggcacagtg
ctaaccataaagtcatatgggatgctggtgaaggtgggcgagcagatgaggggcctggta
cctcccatgcacctggctgacatcctgatgaagaatccggagaagaagtaccacatcggg
gatgaggtcaagtgccgggttttgctttgtgaccctgaagccaagaagctgatgatgacc
ctgaaaaaaaccctgattgagtccaaactacctgtcattacctgctatgccgatgccaag
cctggtctgcagacacatggcttcatcatcagggtcaaggactatggctgcattgtgaag
ttctacaacaatgtgcagggactggtgcccaagcatgagctcagtactgagtatatccct
gacccggagagagttttttacactggccaggtggtgaaggttgtcgtattgaactgtgag
ccatccaaagagaggatgctcttatccttcaagctgtcgagtgatccagagccaaagaaa
gagcctgcaggacacagtcagaagaaaggaaaagccattaacattgggcagttggtagat
gtgaaggttttagagaagaccaaagatgggctggaggtggctgtcctgccccacaacatc
cgtgctttcctccccacatctcatctgtcggaccacgttgccaacggcccattgttacat
cattggctccaggcaggtgacatccttcaccgagtcctgtgtctgagccagagcgagggg
cgtgttcttctttgcaggaagccagccttggtctccacagtagaaggtggccaggatccc
aagaacttctcagaaatccatcctggaatgctgctcattggttttgtgaagagcatcaag
gactatggcgtgttcatccagttcccctcaggtcttagcggactggccccaaaagctatc
atgagtgacaaatttgtgacctccacaagtgaccactttgttgagggccagacagtagcg
gcaaaggtgaccaatgtggatgaggagaagcagcggatgctgctgtcactgcggctgtcg
gactgtggtctgggggacttggctatcaccagcctcctcctcctgaatcagtgcctggag
gagctgcagggcgtgcgcagccttatgagcaaccgagactctgtgttgatccagacgctg
gccgagatgaccccaggaatgttccttgacctagtggtgcaggaggtgttggaagatggc
tctgtggtattcagtgggggtccagtgcccgacctggtcctgaaagccagcagataccat
cgcgcagggcaggaggtggaatctgggcagaaaaagaaggttgttatcttaaatgttgat
cttttgaagttggaagtgcacgtttcccttcaccaggacttggtgaatagaaaagctaga
aagctgaggaaaggcagcgaacaccaggcgattgtgcagcacttggagaagtcctttgcc
attgcctccttggtagagacgggccacctggcagctttctccctgacctctcacctcaac
gacaccttccgctttgactcagagaaattgcaggtgggacagggtgtctccctaaccctc
aagaccacagaaccaggagtgactggccttcttttggctgtggaggggccggctgccaag
aggaccatgaggccgacccagaaggactctgagacagttgatgaggatgaagaagtggat
ccagctctgactgtagggaccataaagaagcacaccctctccatcggggacatggtcaca
gggactgtcaagtccattaagcctacccatgtggttgtgactctggaagatggcattatt
ggctgtatccatgcctcccacattctagatgatgttccagagggcacctctcctactacc
aagctgaaggttgggaagacggtcactgcccgagtgattggcgggcgagacatgaagaca
ttcaagtatctcccaataagtcaccccagattcgttcgaaccatcccggagctgagtgtt
cggccaagtgagctggaggatggccacactgctcttaacactcactctgttagccccatg
gagaagattaaacagtaccaggccggccagactgttacttgcttcttaaagaaatacaat
gtggtgaagaaatggcttgaggtggagattgccccagacatccgggggagaattccctta
ttgctcacttctctgagcttcaaggttctgaagcatccagataagaagttccgggttggc
caggccctgagggccaccgttgttggcccagattcctccaagaccctcttatgtctgtcc
ctcacaggtcctcacaagcttgaggaaggggaagtggccatgggccgagtggtgaaggtg
actcccaacgaggggctgaccgtctccttcccctttgggaagataggaacagtcagtata
tttcacatgagtgactcctactccgagacgcccctggaagacttcgtcccccagaaggtt
gtcagatgttacatcctgtccactgcagacaacgtattgactttgtcgctgcgatcatcc
agaacaaacccggagacgaaaagcaaagtagaagatccagagattaactccatccaggac
attaaggaagggcagcttctgaggggctatgtagggtccatccagccacacggtgtgttc
tttcgccttggcccctccgttgtgggtttggctcggtactcccatgtctcccagcacagc
ccgtccaagaaagccctttataacaaacacctccctgaagggaagctgctcacagccagg
gtcctacgccttaaccaccagaagaacctggtagagctgtctttcctccccggagacact
gggaagccagacgtgctttctgcttccttggaagggcaacttacaaagcaagaggagagg
aaaacagaggctgaggagagagaccaaaaaggggaaaagaaaaatcagaaaaggaacgag
aagaagaaccagaaggggcaggaggaggtggagatgcccagcaaggagaagcaacagccc
cagaagccacaggcgcagaagcggggcgggcgggagtgccgggagtctgggagtgagcag
gaaagagtgagcaagaagccaaagaaagccggcctgtcagaggaggacgacagccttgtg
gacgtgtactatcgggagggaaaagaggaggcagaagagacgaatgtgctgcccaaggag
aagcaaaccaagccagcagaagcgccccggctgcagctgtcttcaggcttcgcttggaat
gtgggactagactctctgaccccggccttgccacctctagcagagagctcagacagcgag
gaggatgagaagccacaccaagccacgataaagaaaagcaagaaagaaagggagttggag
aagcagaaggcagagaaggaactgtcccgcattgaggaggcgctgatggatcctgggcgg
cagccagagtccgcggatgattttgaccgactggtgctgagctcccccaacagctccatt
ctgtggctgcagtacatggctttccacctgcaggccacggagatcgagaaggcccgtgcc
gtggctgagagggcccttaagaccatctccttcagagaggagcaggagaagctgaacgtg
tgggtggctctgctgaacctggagaacatgtacggctctcaggagtccctgaccaaggtc
tttgagcgagccgtgcagtacaacgagcctctcaaagtctttctccacctggctgacatc
tacgccaagtcagagaaattccaggaagctggtgaactctacaaccggatgctgaagcgt
ttccggcaggagaaagctgtgtggatcaaatacggcgccttccttctgcggaggagccag
gctgcagccagtcaccgcgtgctgcagcgagccctggagtgcctgcctagcaaggagcat
gtggatgtcattgccaagtttgcccagcttgagtttcagctgggggatgcagagcgggcc
aaagccatttttgagaacacgctgagcacctacccaaagcgcacagatgtctggtcggtc
tatatcgacatgaccatcaagcacggcagccagaaggacgtccgggacatctttgagcgg
gtcattcatctgagcttggcccccaagagaatgaagttcttcttcaagcgctacctggac
tacgagaagcagcatggcactgagaaggatgtgcaggcagtcaaggccaaggccctggag
tatgtggaggccaagagctcagtgctagaggactag

DBGET integrated database retrieval system