KEGG   Homo sapiens (human): 22989
Entry
22989             CDS       T01001                                 

Gene name
MYH15
Definition
(RefSeq) myosin heavy chain 15
  KO
K24220  myosin heavy chain 1/2/3/4/8/13/7B/15
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    22989 (MYH15)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     22989 (MYH15)
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N TsaE Crescentin
Other DBs
NCBI-GeneID: 22989
NCBI-ProteinID: NP_055796
OMIM: 609929
HGNC: 31073
Ensembl: ENSG00000144821
Vega: OTTHUMG00000159226
Pharos: Q9Y2K3(Tbio)
UniProt: Q9Y2K3
Position
3q13.13
AA seq 1946 aa
MVESCLLTFRAFFWWIALIKMDLSDLGEAAAFLRRSEAELLLLQATALDGKKKCWIPDGE
NAYIEAEVKGSEDDGTVIVETADGESLSIKEDKIQQMNPPEFEMIEDMAMLTHLNEASVL
HTLKRRYGQWMIYTYSGLFCVTINPYKWLPVYQKEVMAAYKGKRRSEAPPHIFAVANNAF
QDMLHNRENQSILFTGESGAGKTVNSKHIIQYFATIAAMIESRKKQGALEDQIMQANTIL
EAFGNAKTLRNDNSSRFGKFIRMHFGARGMLSSVDIDIYLLEKSRVIFQQAGERNYHIFY
QILSGQKELHDLLLVSANPSDFHFCSCGAVTVESLDDAEELLATEQAMDILGFLPDEKYG
CYKLTGAIMHFGNMKFKQKPREEQLEADGTENADKAAFLMGINSSELVKCLIHPRIKVGN
EYVTRGQTIEQVTCAVGALSKSMYERMFKWLVARINRALDAKLSRQFFIGILDITGFEIL
EYNSLEQLCINFTNEKLQQFFNWHMFVLEQEEYKKESIEWVSIGFGLDLQACIDLIEKPM
GILSILEEECMFPKATDLTFKTKLFDNHFGKSVHLQKPKPDKKKFEAHFELVHYAGVVPY
NISGWLEKNKDLLNETVVAVFQKSSNRLLASLFENYMSTDSAIPFGEKKRKKGASFQTVA
SLHKENLNKLMTNLKSTAPHFVRCINPNVNKIPGILDPYLVLQQLRCNGVLEGTRICREG
FPNRLQYADFKQRYCILNPRTFPKSKFVSSRKAAEELLGSLEIDHTQYRFGITKVFFKAG
FLGQLEAIRDERLSKVFTLFQARAQGKLMRIKFQKILEERDALILIQWNIRAFMAVKNWP
WMRLFFKIKPLVKSSEVGEEVAGLKEECAQLQKALEKSEFQREELKAKQVSLTQEKNDLI
LQLQAEQETLANVEEQCEWLIKSKIQLEARVKELSERVEEEEEINSELTARGRKLEDECF
ELKKEIDDLETMLVKSEKEKRTTEHKVKNLTEEVEFLNEDISKLNRAAKVVQEAHQQTLD
DLHMEEEKLSSLSKANLKLEQQVDELEGALEQERKARMNCERELHKLEGNLKLNRESMEN
LESSQRHLAEELRKKELELSQMNSKVENEKGLVAQLQKTVKELQTQIKDLKEKLEAERTT
RAKMERERADLTQDLADLNERLEEVGGSSLAQLEITKKQETKFQKLHRDMEEATLHFETT
SASLKKRHADSLAELEGQVENLQQVKQKLEKDKSDLQLEVDDLLTRVEQMTRAKANAEKL
CTLYEERLHEATAKLDKVTQLANDLAAQKTKLWSESGEFLRRLEEKEALINQLSREKSNF
TRQIEDLRGQLEKETKSQSALAHALQKAQRDCDLLREQYEEEQEVKAELHRTLSKVNAEM
VQWRMKYENNVIQRTEDLEDAKKELAIRLQEAAEAMGVANARNASLERARHQLQLELGDA
LSDLGKVRSAAARLDQKQLQSGKALADWKQKHEESQALLDASQKEVQALSTELLKLKNTY
EESIVGQETLRRENKNLQEEISNLTNQVREGTKNLTEMEKVKKLIEEEKTEVQVTLEETE
GALERNESKILHFQLELLEAKAELERKLSEKDEEIENFRRKQQCTIDSLQSSLDSEAKSR
IEVTRLKKKMEEDLNEMELQLSCANRQVSEATKSLGQLQIQIKDLQMQLDDSTQLNSDLK
EQVAVAERRNSLLQSELEDLRSLQEQTERGRRLSEEELLEATERINLFYTQNTSLLSQKK
KLEADVARMQKEAEEVVQECQNAEEKAKKAAIEAANLSEELKKKQDTIAHLERTRENMEQ
TITDLQKRLAEAEQMALMGSRKQIQKLESRVRELEGELEGEIRRSAEAQRGARRLERCIK
ELTYQAEEDKKNLSRMQTQMDKLQLKVQNYKQQVEVAETQANQYLSKYKKQQHELNEVKE
RAEVAESQVNKLKIKAREFGKKVQEE
NT seq 5841 nt   +upstreamnt  +downstreamnt
atggttgaatcttgcctactcacgtttagggcctttttttggtggattgctttaataaag
atggatctgtcagaccttggagaagccgcagccttcctcagaagaagtgaagctgagctg
cttctactacaggccacagccttggatgggaagaagaaatgctggattcctgatggtgag
aatgcttatatcgaggctgaggtaaaagggagtgaagatgatggaacagtaattgttgag
acagcagatggagagagtctgagcataaaggaggacaaaatccagcagatgaatcctcca
gagtttgaaatgattgaagacatggcaatgctgactcacctcaatgaggcatccgtgctg
cataccctgaagcggcgctatggccagtggatgatctatacatattcaggtctcttctgt
gtgaccataaacccttacaaatggcttcccgtgtatcagaaagaagtcatggccgcctac
aaagggaagaggcgatcagaggctccccctcacatctttgctgttgccaataacgccttt
caggacatgcttcacaatcgagaaaatcagtctatactcttcacaggagaatctggtgct
ggaaagactgtgaacagcaaacatattatccagtattttgccaccatagcagccatgatt
gaatccaggaaaaagcagggggcgttagaagatcaaatcatgcaagcgaatactatcttg
gaagcatttggaaatgctaaaaccctgagaaatgacaactcctctcgttttggcaaattc
atcaggatgcactttggtgccagaggcatgctgtcatctgtggacattgatatctatttg
cttgaaaagtccagggtgattttccagcaggctggagagaggaactaccacatattctat
caaattctatctggacaaaaagagcttcatgacctgctcctggtatctgcaaatccctca
gacttccacttttgctcctgtggagcagttactgtggagagcttggatgatgctgaagaa
ttgctggccacagaacaagccatggacatcttgggctttcttcctgatgagaagtatgga
tgctataaactcactggagccatcatgcactttggaaatatgaaatttaaacagaaacct
agagaagagcaactggaagcagatggcacagaaaatgctgacaaagctgctttcctcatg
ggcattaactcctctgagttggtaaagtgcttgatccatcctagaatcaaagttggtaac
gaatatgttaccagaggtcaaactatagaacaggtaacctgtgctgtcggtgccctgtcc
aagtcaatgtatgaaaggatgtttaagtggctagtggcacggatcaacagggccctggat
gccaagctgtcaaggcagttcttcattggcattcttgacatcactggttttgaaatcctt
gagtataatagccttgagcaactttgcattaattttaccaatgaaaaattacaacaattc
ttcaattggcacatgtttgttctggagcaagaggaatataagaaagaaagcattgaatgg
gtgtctattggctttggtctggatttgcaagcttgcatagatctcattgagaagccaatg
ggcatcctttccatccttgaagaagagtgtatgtttcctaaggctacagacctgactttc
aagaccaaactctttgacaaccattttggaaagtcggttcatctccagaagcccaagcct
gataagaagaaatttgaagctcattttgaacttgtccattatgcaggagtggtaccttat
aatatcagtggttggctggaaaagaacaaagacctccttaatgaaacagtggtagctgta
tttcagaagtcttccaacagactcctggcgagcctttttgaaaattacatgagtactgac
agtgctataccatttggggagaagaaacgaaagaaaggagcttcattccaaacggttgca
tctctgcataaagaaaacctgaataaattgatgactaatctgaaatcaacagcacctcat
tttgtgagatgcataaatcccaatgtgaacaaaataccaggtatactggacccttacttg
gttctacagcagttgcgctgtaatggtgtcttggaagggactaggatatgccgtgaaggt
tttccaaaccgactgcagtatgctgattttaaacaaaggtactgcattctgaatccaagg
acctttccaaagagcaagtttgtgagcagcagaaaagcagctgaagaattacttggctcc
ttggagatagaccatacccagtaccgatttggaatcactaaggtgttttttaaagctggg
tttctgggccaactggaagcaataagagatgagagactatctaaagtcttcacattgttc
caagccagagcacagggcaaactgatgcgaatcaaattccagaagattctggaagaaagg
gatgcacttattttgatccaatggaacataagagctttcatggctgtgaagaactggccc
tggatgaggctcttcttcaagatcaagcctcttgttaaatcttcagaagtaggagaagaa
gtagctggactgaaggaagagtgtgcacaattacagaaagccttggagaaatcagagttt
cagagggaggaactgaaagcaaagcaagtatccctcactcaggaaaaaaatgacctgatt
cttcagcttcaggctgagcaagagacactggcaaatgttgaagagcagtgcgagtggctg
attaaatccaagatccagctggaggccagagtaaaggagctgtcggagagggtggaggaa
gaagaggagataaattctgagctgactgccagggggcggaaactcgaagatgaatgtttt
gagttgaagaaagaaatcgatgacctggaaacaatgttggtgaagtcagagaaggagaag
cgtactacagagcacaaggtcaagaacttgactgaggaagtagagtttctaaatgaggat
atcagcaaacttaacagagcagccaaggttgtgcaggaggcccatcagcagaccctggat
gacctgcacatggaggaggagaagctcagcagcctgagcaaagcaaatctgaagctggaa
cagcaagttgatgagcttgagggtgcccttgagcaggagagaaaagcgagaatgaactgt
gaaagggaactgcacaaactggagggcaatttaaagctgaatcgggaaagtatggagaac
ctggaaagcagccagcgacacctggcagaagagctgaggaaaaaagaattagaattgagt
cagatgaattcaaaagtggagaatgagaaaggcctggtagctcagcttcagaagacggtt
aaagagcttcagactcaaataaaggatttgaaagagaaactagaagctgaaaggaccact
cgagccaagatggaaagggagagagctgacctcacccaagacctggctgacttgaatgag
aggctggaggaggtaggaggatccagtttggctcagctggaaataactaagaaacaggaa
accaaattccagaagctgcaccgagacatggaagaggccactctgcactttgagacaact
tctgcatctttgaagaagagacatgcagacagcctggctgagctcgagggccaggtagaa
aatctacagcaggtcaagcagaaactggaaaaagacaagagtgacttgcagctagaagta
gatgacctcctgacccgtgttgagcagatgacaagagctaaggcaaatgctgagaaactc
tgtactctatatgaagagcgcttgcatgaagcaactgcaaagctagataaggtgactcag
ttggcaaatgacctggcagcacaaaagacaaagctgtggagtgagagtggcgagttccta
cggaggcttgaagagaaggaggctctgataaaccaactttccagggaaaagagcaacttc
actcggcagattgaagacctgagagggcagctggaaaaggagaccaaatcccagagtgcc
ctggcccatgccctgcagaaggctcagcgtgactgtgaccttctacgagagcagtatgag
gaagaacaagaggtcaaggctgagctgcaccggaccttatccaaagtcaatgctgaaatg
gtgcaatggagaatgaagtatgaaaacaatgtcatccagagaacagaagacttggaggat
gccaagaaggaactggcaattagattgcaggaggcagccgaagccatgggggtggccaat
gccagaaatgcctccttggagagagccaggcaccagctgcagctggagctcggggacgcc
ctgtctgacctcgggaaggtccgctctgcagcagccaggctggaccagaagcagctgcag
tctggcaaggcccttgccgactggaagcagaagcacgaggagtcccaggcgttgctggat
gcctctcagaaggaagttcaggctctcagtacagagctcctcaagctcaagaacacctat
gaggagagcatcgtgggccaggagacactcaggagggagaacaagaacctccaagaagag
atttctaatctgacaaaccaggttagagaagggaccaagaacttaactgaaatggaaaag
gtcaagaaactaattgaagaagagaagacagaagtccaggtgacactggaagaaacagag
ggagccctggaacgtaatgaaagcaagattcttcatttccagcttgaactcttggaagct
aaagcagaacttgaaagaaagctttcagagaaagatgaagaaatagaaaattttaggagg
aagcagcagtgtaccattgactccctgcagtctagtctggattctgaagctaagagcaga
attgaggttacccggctgaagaagaagatggaagaggacctcaatgagatggaactccag
cttagctgtgccaaccggcaggtgtcagaagcaaccaaatccctgggccagcttcagatt
caaatcaaggaccttcaaatgcagctggatgacagcacacaactgaacagtgatctgaag
gagcaggtggctgtggctgagcggcgcaactctcttcttcagtctgaactagaggatcta
aggtccctgcaagagcagacagagcgtggccgcaggctgtcagaagaagagctcctggaa
gcaacagaaagaatcaatcttttctatacccagaacacaagcctcctcagccagaagaag
aaactggaggctgatgttgcccggatgcagaaagaagctgaagaggtggtgcaggagtgt
caaaatgcagaagagaaggccaagaaggcagccattgaggcagcaaacttgtcagaagaa
ctgaagaagaagcaagacaccattgcccacttggaaaggacaagagaaaatatggagcag
acaattacagacttacagaaaaggctggctgaagctgaacagatggccctgatggggagt
agaaagcaaatccagaaactagaatccagggttcgtgaactggaaggtgaactggagggt
gaaatccgtcgcagtgcagaggcccagaggggagcccgcagacttgagcgatgcatcaaa
gagctgacctatcaggcagaggaagacaagaagaatctgagcaggatgcaaactcagatg
gataaacttcagctaaaagtgcaaaattacaagcagcaagtcgaggtggcggaaacacaa
gccaatcaatacctttccaagtataagaaacagcaacatgagttgaatgaagtgaaggaa
agggcagaggtggcagaatctcaagtcaataaactcaaaattaaagcaagagagtttggg
aaaaaggttcaagaagaatag

DBGET integrated database retrieval system