KEGG   Homo sapiens (human): 23002Help
Entry
23002             CDS       T01001                                 

Gene name
DAAM1
Definition
(RefSeq) dishevelled associated activator of morphogenesis 1
  KO
K04512  dishevelled associated activator of morphogenesis
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    23002 (DAAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    23002 (DAAM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   23002 (DAAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FH2 Drf_FH3 Drf_GBD Mito_fiss_reg APG6_N TPR_MLP1_2 DUF948
Motif
Other DBs
NCBI-GeneID: 23002
NCBI-ProteinID: NP_055807
OMIM: 606626
HGNC: 18142
Ensembl: ENSG00000100592
Vega: OTTHUMG00000140326
Pharos: Q9Y4D1(Tbio)
UniProt: Q9Y4D1
Structure
PDB: 

Position
14q23.1
AA seq 1078 aa AA seqDB search
MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSEL
VDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLL
ALEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTS
LIGCIKALMNNSQGRAHVLAHSESINVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKV
LQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF
RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFELVHIDTKSA
TQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ
DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEK
EEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPF
PSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKK
KSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQDFFV
NSNSKQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQ
EDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHYQQRLQSLYFK
KKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSL
NKIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLR
SGLKAVETELEYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHF
GEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKM
RKAKENSEESGEFDDLVSALRSGEVFDKDLSKLKRNRKRITNQMTDSSRERPITKLNF
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atggccccaagaaagagaggtggacgaggtatttcattcatcttttgctgtttccgaaat
aatgatcacccagaaatcacgtatcggctgcgaaatgatagcaactttgcgcttcagacc
atggaaccagcattgcccatgccccctgtggaggagctggatgtcatgttcagtgaactg
gtggatgaactggacctcacagacaaacacagagaagccatgtttgcacttccagctgag
aaaaaatggcaaatatactgtagcaagaaaaaggaccaggaagaaaacaagggagctaca
agttggcctgaattctacattgatcagctcaattccatggctgctagaaaatctctgctg
gctttagagaaggaagaagaagaagaaagaagtaaaactatagagagtttaaagacagca
ctgaggacaaaaccaatgaggtttgtaaccagattcatcgacttggatggcctatcatgt
atcctcaactttctaaagaccatggactacgagacctcagagtctcgaatacatacttct
ctcattggctgtataaaggcgttaatgaacaactctcaaggccgggctcacgtcctggct
cattctgagagtattaatgtaattgctcagagtctgagcacagagaacattaaaacgaag
gtggccgtgctggaaatcttgggcgccgtgtgcctggttcccgggggccacaagaaggtt
ctgcaggccatgctgcactaccagaagtatgccagcgaaaggacccgctttcagacatta
attaacgacttggataaaagcactgggcggtatcgagatgaagtgagtctcaagactgcc
atcatgtccttcattaatgcagtgctcagccaaggtgcaggagtggagagtttggacttt
agacttcatcttcgctatgaatttctgatgttaggaattcaacctgtaatagataaatta
agggaacacgaaaattcaacattagataggcatttagacttttttgaaatgctccgaaat
gaagatgaactagaatttgccaaaagatttgaactggttcacatagacacaaaaagtgca
actcagatgtttgagctgaccaggaagaggctgacacatagtgaagcttacccgcatttc
atgtccatcctgcaccactgcctccaaatgccttacaagaggagtggcaacactgttcag
tactggctactactagatagaattatacagcagatagttatccagaatgacaaaggacag
gaccctgactccacacctttggaaaactttaatattaagaatgtcgtacgaatgttggtt
aatgaaaatgaagttaagcagtggaaagaacaagcggaaaaaatgagaaaagagcacaat
gagctacaacagaaactggaaaagaaagaacgagaatgtgatgctaagactcaagagaag
gaagagatgatgcagaccttaaataaaatgaaagagaaacttgaaaaggagactactgag
cataagcaagtcaagcagcaggtggcggacctcacagcacagctccatgagctcagcagg
agggccgtctgtgcttcaatcccaggtggaccctcgcctggagcaccaggagggcccttt
ccttcctctgtgcctggatctctccttcctcccccaccacccccacctctaccaggtggg
atgcttccccctccaccgcctcccctccctccaggtggccctcctcctcccccagggcct
cctcccttaggggcaatcatgccacctcctggtgctccaatgggcctagcactgaagaag
aaaagcattcctcagcccacaaatgccctgaaatccttcaactggtctaaactgcccgag
aacaaactggaaggaacagtatggaccgaaattgatgatacaaaagtcttcaaaattcta
gatcttgaagacctggaaagaaccttctctgcctatcaaagacagcaggatttctttgtg
aacagtaactccaagcagaaagaagcagatgccattgatgacactctgagttccaaactt
aaagttaaagagctttcggtgattgatggtcggagagctcagaattgcaacatccttcta
tcgaggttgaaattatccaatgacgaaatcaaacgggcaattctaacaatggacgaacag
gaagatctgcccaaggacatgttggaacagctcttgaaatttgttcctgaaaaaagtgac
attgacctattggaggaacataaacacgaactggatcggatggccaaggctgataggttc
ctttttgagatgagccgaattaatcactatcagcaaaggttgcaatcgctgtacttcaaa
aagaagtttgcagagcgtgtggcagaagtgaaacctaaagtggaagcaattcgttctggc
tcagaagaggtgtttaggagtggtgccctcaagcagttgctggaggtggttttggcattt
ggaaattatatgaataaaggtcaaagagggaatgcatatggattcaagatatctagccta
aacaaaattgctgacacaaaatccagcatcgacaaaaacattacccttttgcactatctc
atcactattgtggaaaataagtaccccagtgttctcaatctaaatgaagaattgcgagat
attcctcaagctgcgaaagtaaacatgactgagctggacaaagaaataagtaccttgaga
agtggcttgaaagcagtagagacagagctggaatatcagaagtctcagcccccacagccc
ggagataagtttgtgtctgttgtcagccagttcatcacagtagccagcttcagcttctct
gatgttgaagaccttctagcagaagctaaagacctgtttactaaagcagtgaagcacttt
ggggaagaggctggcaaaatacaaccagatgagttctttggcatttttgatcaatttctt
caagctgtgtcagaagccaaacaagaaaacgaaaatatgagaaagaaaaaggaggaagaa
gaacgtcgagctcgcatggaagctcagctcaaagaacaacgtgaaagggaacgtaaaatg
agaaaagctaaagagaatagtgaagaaagcggagagtttgatgaccttgtttcagcttta
cgctcaggagaagtgtttgacaaagacctttctaaattgaaacggaatcgcaaacgtatt
accaaccagatgactgacagcagcagagagagaccaatcacaaaacttaatttctaa

DBGET integrated database retrieval system