KEGG   Homo sapiens (human): 2301
Entry
2301              CDS       T01001                                 

Gene name
FOXE3, AAT11, ASGD2, CTRCT34, FKHL12, FREAC8
Definition
(RefSeq) forkhead box E3
  KO
K09398  forkhead box protein E
Organism
hsa  Homo sapiens (human)
Disease
H00676  Congenital primary aphakia
H00801  Familial thoracic aortic aneurysm and dissection
H01159  Anterior segment dysgenesis
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2301 (FOXE3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    2301 (FOXE3)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 2301
NCBI-ProteinID: NP_036318
OMIM: 601094
HGNC: 3808
Ensembl: ENSG00000186790
Vega: OTTHUMG00000007954
Pharos: Q13461(Tbio)
UniProt: Q13461 A0A0A1EII5
Position
1p33
AA seq 319 aa
MAGRSDMDPPAAFSGFPALPAVAPSGPPPSPLAGAEPGREPEEAAAGRGEAAPTPAPGPG
RRRRRPLQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIR
HNLTLNDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRAELPAHAAAAP
GPPLPFPYAPYAPAPGPALLVPPPSAGPGPSPPARLFSVDSLVNLQPELAGLGAPEPPCC
AAPDAAAAAFPPCAAAASPPLYSQVPDRLVLPATRPGPGPLPAEPLLALAGPAAALGPLS
PGEAYLRQPGFASGLERYL
NT seq 960 nt   +upstreamnt  +downstreamnt
atggcggggcgcagcgacatggatccgcccgccgcgttctctggcttccctgccctgcca
gcggtcgcgccgtcggggccgccgccgtcgccgctcgcaggagccgagccagggcgggag
ccagaggaggcggcggctggccgcggagaggcggcccccacgcccgcgcccggcccgggg
cggcggcggcggcggcccctgcagcgcgggaagccgccctactcgtacatcgcgctcatc
gccatggctctggcgcacgccccgggccgccgcctcacgctggccgccatctaccgcttc
atcaccgaacgctttgccttctaccgcgacagcccgcgcaagtggcagaacagcatccgc
cacaatctcacgctcaacgactgcttcgtcaaggtgccccgcgagccgggcaacccgggc
aagggcaactactggacgctggaccccgcggccgcagacatgttcgacaacggcagcttc
ctgcggcgccgcaagcgcttcaagcgcgccgagctgcccgcgcacgcggccgcggcgcca
gggccgccgctccccttcccctacgcgccctacgcgcccgcgcccggccccgcgctgctg
gtgccgccgccttctgccggaccgggcccctcgccgcccgcgcgtctgttcagcgtcgac
agcctggtgaacctgcagccggagctagcggggctgggcgcccccgagccgccctgctgc
gccgcgcccgacgccgcagccgcagccttcccgccctgcgctgccgccgcctccccgcca
ctctactcgcaggtccccgaccgcctggtactgcccgcgacgcgccccggccccggcccg
ctgcccgctgagcccctcctggccttggccgggccggcagccgctctcggcccgctcagc
cctggggaggcctacctgaggcagccgggcttcgcgtcggggctggagcgctacctgtga

DBGET integrated database retrieval system