KEGG   Homo sapiens (human): 23011Help
Entry
23011             CDS       T01001                                 

Gene name
RAB21
Definition
(RefSeq) RAB21, member RAS oncogene family
  KO
K07890  Ras-related protein Rab-21
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23011 (RAB21)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    23011 (RAB21)
   04031 GTP-binding proteins [BR:hsa04031]
    23011 (RAB21)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    23011 (RAB21)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   23011 (RAB21)
  Exosomal proteins of other body fluids (saliva and urine)
   23011 (RAB21)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab20/21/24 [OT]
    23011 (RAB21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 Gtr1_RagA PduV-EutP FeoB_N
Motif
Other DBs
NCBI-GeneID: 23011
NCBI-ProteinID: NP_055814
OMIM: 612398
HGNC: 18263
Ensembl: ENSG00000080371
Vega: OTTHUMG00000169572
Pharos: Q9UL25(Tbio)
UniProt: Q9UL25 A0A024RBA9
Structure
PDB: 

Position
12q21.1
AA seq 225 aa AA seqDB search
MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKK
LNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKM
LGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRM
IETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggccggcggcggcggcggcggggcggcggcggcgggccgagcctactcgttc
aaggtggtgctgctgggggaaggctgcgtggggaagacgtcgctggtgctgcgctactgc
gagaacaagtttaacgacaagcacatcaccactctgcaggcatcattcttaacaaagaag
ttaaatattggtgggaaaagagtaaaccttgccatatgggatacggcaggtcaagagaga
ttccatgcattgggtccaatttactacagagattcaaatggagcgattttagtttatgac
ataacagatgaagattcttttcagaaggtaaaaaactgggtcaaagaattacggaaaatg
ttgggaaatgaaatctgtttatgtatagttggtaataaaatagacttggaaaaggagaga
catgtttccattcaagaagcagagtcgtatgcagaatctgtgggagcaaaacattatcat
acttcagccaaacagaacaaaggaattgaggaactctttcttgacctttgtaaaaggatg
atagaaacagcacaagtggatgagagagcaaaaggcaatggctctagtcagccgggaact
gcaaggcgaggtgtacagattattgatgatgaacctcaagcccagaccagtggtggaggg
tgctgttcttctggataa

DBGET integrated database retrieval system