KEGG   Homo sapiens (human): 23012Help
Entry
23012             CDS       T01001                                 

Gene name
STK38L, NDR2
Definition
(RefSeq) serine/threonine kinase 38 like
  KO
K08790  serine/threonine kinase 38 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    23012 (STK38L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23012 (STK38L)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  NDR family
   23012 (STK38L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Haspin_kinase APH Kdo RIO1 Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 23012
NCBI-ProteinID: NP_055815
OMIM: 615836
HGNC: 17848
Ensembl: ENSG00000211455
Vega: OTTHUMG00000169284
Pharos: Q9Y2H1(Tchem)
UniProt: Q9Y2H1
Structure
PDB: 

Position
12p11.23
AA seq 464 aa AA seqDB search
MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLAD
EEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKI
LRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLM
KKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKK
AHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGY
NKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILR
FCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDIL
QPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgacggcagggactacaacaacctttcctatgagcaaccatacccgggaaaga
gtgactgtagccaagctcacattggagaatttttatagcaacctaattttacagcatgaa
gagagagaaaccaggcagaagaaattagaagtggccatggaagaagaaggattagcagat
gaagagaaaaagttacgtcgatcacaacacgctcgcaaagaaacagagttcttacggctc
aaaaggaccagacttggcttggatgactttgagtctctgaaagttataggaagaggagct
tttggagaggtgcggttggtccagaagaaagatacaggccatatctatgcaatgaagata
ttgagaaagtctgatatgcttgaaaaagagcaggtggcccatatccgagcagaaagagat
attttggtagaagcagatggtgcctgggtggtgaagatgttttacagttttcaggataag
aggaatctttatctaatcatggaatttctccctggaggtgacatgatgacattgctaatg
aagaaagacaccttgacagaagaggaaacacagttctacatttcagagactgttctggca
atagatgcgatccaccagttgggtttcatccatcgggatattaagccagacaacctttta
ttggatgccaagggtcatgtaaaattatctgattttggtttatgtacgggattaaagaaa
gctcacaggactgaattttatagaaatctcacacacaacccaccaagtgacttctcattt
cagaacatgaactcaaagaggaaagcagaaacttggaagaagaacaggagacaactggca
tattccacagttgggacaccagattacattgctccagaagtattcatgcagactggttac
aacaaattgtgtgactggtggtctttgggagtgattatgtatgaaatgctaataggatat
ccacctttctgctctgaaacacctcaagaaacgtacagaaaagtgatgaactggaaagaa
actctggtatttcctccagaggtacctatatctgagaaagccaaggacttaattctcaga
ttttgtattgattctgaaaacagaattggaaatagtggagtagaagaaataaaaggtcat
cccttttttgaaggtgtcgactgggagcacataagggaaaggccagcagcaatccctata
gaaatcaaaagcattgatgatacttcaaattttgatgacttccctgaatctgatatttta
caaccagtgccaaataccacagaaccggactacaaatccaaagactgggtttttctcaat
tatacctataaaaggtttgaagggttgactcaacgtggctctatccccacctacatgaaa
gctgggaagttatga

DBGET integrated database retrieval system