KEGG   Homo sapiens (human): 2302Help
Entry
2302              CDS       T01001                                 

Gene name
FOXJ1, CILD43, FKHL13, HFH-4, HFH4
Definition
(RefSeq) forkhead box J1
  KO
K09402  forkhead box protein J1
Organism
hsa  Homo sapiens (human)
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2302 (FOXJ1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix tissue-specific regulators
    2302 (FOXJ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 2302
NCBI-ProteinID: NP_001445
OMIM: 602291
HGNC: 3816
Ensembl: ENSG00000129654
Vega: OTTHUMG00000180120
Pharos: Q92949(Tbio)
UniProt: Q92949 A0A024R8P1
Position
17q25.1
AA seq 421 aa AA seqDB search
MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGGTDPH
GYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHV
KPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFI
KVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGP
LTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQG
ELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWG
PSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAF
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcggagagctggctgcgcctctcgggagccgggccggcggaggaggccgggccggag
ggcggcctggaggagcccgacgccctggatgacagcctgaccagcctgcagtggctgcag
gaattctccattctcaacgccaaggcccccgccctgcccccggggggcaccgacccccac
ggctaccaccaggtgccaggttcagcggcgcccgggtcccccctggcggccgaccccgcc
tgcctggggcagccacacacgccgggcaagcccacgtcgtcgtgcacgtcgcggagcgcg
cccccggggctgcaggccccaccccccgacgacgtggactacgccaccaatccgcacgtg
aagcctccctactcgtatgccacgctcatctgcatggccatgcaggccagcaaggccacc
aagatcaccctgtcggccatctacaagtggatcacggacaacttctgctacttccgccac
gcagatcccacctggcagaattcaatccgccacaacctgtctctgaacaagtgcttcatc
aaagtgcctcgggagaaggacgaaccaggcaaggggggcttctggcgcattgacccccag
tacgcggagcggctactgagcggcgctttcaagaagcggcgactgccccctgtccacatc
cacccagcctttgcccgccaggccgcgcaggagcccagcgctgtcccccgggccgggccg
ctgacggtgaataccgaggcccagcagctgctgcgggagttcgaggaggccaccggggag
gcgggctggggtgcaggcgagggcaggctggggcataagcgcaaacagccgctgcccaag
cgggtggccaaggtcccgcggccccccagcaccctgctgcccaccccggaggagcagggt
gagctggaacccctcaaaggcaactttgactgggaggccatcttcgacgccggcactctg
ggcggggagctgggtgcactggaggccctggagctgagcccgcctctgagccccgcctca
cacgtggacgtggacctcaccatccacggccgccacatcgactgccctgccacctggggg
ccttcggtggagcaggctgccgacagcctggacttcgatgagaccttcctggccacatcc
ttcctgcagcacccctgggacgagagcggcagtggctgcctgcccccggagcccctcttt
gaggctggggatgccaccctggcctccgacctgcaggactgggccagcgtgggggccttc
ttgtaa

DBGET integrated database retrieval system