KEGG   Homo sapiens (human): 23028Help
Entry
23028             CDS       T01001                                 

Gene name
KDM1A, AOF2, BHC110, CPRF, KDM1, LSD1
Definition
(RefSeq) lysine demethylase 1A
  KO
K11450  [histone H3]-N6,N6-dimethyl-L-lysine4 FAD-dependent demethylase [EC:1.14.99.66]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    23028 (KDM1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23028 (KDM1A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.66  [histone H3]-N6,N6-dimethyl-L-lysine4 FAD-dependent demethylase
     23028 (KDM1A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    23028 (KDM1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase SWIRM NAD_binding_8 DAO Pyr_redox_2 AlaDh_PNT_C Pyr_redox FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 GIDA 2-Hacid_dh_C DUF1917 Lycopene_cycl MutS_IV Pyr_redox_3 MRPL52
Motif
Other DBs
NCBI-GeneID: 23028
NCBI-ProteinID: NP_055828
OMIM: 609132
HGNC: 29079
Ensembl: ENSG00000004487
Vega: OTTHUMG00000003220
Pharos: O60341(Tchem)
UniProt: O60341
Structure
PDB: 

Position
1p36.12
AA seq 852 aa AA seqDB search
MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTP
RKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEY
REMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQ
SRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEA
PYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSF
GMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKC
PLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE
KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLV
KSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFAN
ATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGC
EVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLN
KVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISD
DVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPI
TPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQA
TPGVPAQQSPSM
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgggaagaaggcggcagccgcggcggcggcggctgcagcggcagcaaccggg
acggaggctggccctgggacagcaggcggctccgagaacgggtctgaggtggccgcgcag
cccgcgggcctgtcgggcccagccgaggtcgggccgggggcggtgggggagcgcacaccc
cgcaagaaagagcctccgcgggcctcgccccccgggggcctggcggaaccgccggggtcc
gcagggcctcaggccggccctactgtcgtgcctgggtctgcgacccccatggaaactgga
atagcagagactccggaggggcgtcggaccagccggcgcaagcgggcgaaggtagagtac
agagagatggatgaaagcttggccaacctctcagaagatgagtattattcagaagaagag
agaaatgccaaagcagagaaggaaaagaagcttcccccaccaccccctcaagccccacct
gaggaagaaaatgaaagtgagcctgaagaaccatcgggtgtggagggcgcagctttccag
agccgacttcctcatgaccggatgacttctcaagaagcagcctgttttccagatattatc
agtggaccacaacagacccagaaggtttttcttttcattagaaaccgcacactgcagttg
tggttggataatccaaagattcagctgacatttgaggctactctccaacaattagaagca
ccttataacagtgatactgtgcttgtccaccgagttcacagttatttagagcgtcatggt
cttatcaacttcggcatctataagaggataaaacccctaccaactaaaaagacaggaaag
gtaattattataggctctggggtctcaggcttggcagcagctcgacagttacaaagtttt
ggaatggatgtcacacttttggaagccagggatcgtgtgggtggacgagttgccacattt
cgcaaaggaaactatgtagctgatcttggagccatggtggtaacaggtcttggagggaat
cctatggctgtggtcagcaaacaagtaaatatggaactggccaagatcaagcaaaaatgc
ccactttatgaagccaacggacaagctgttcctaaagagaaagatgaaatggtagagcaa
gagtttaaccggttgctagaagctacatcttaccttagtcatcaactagacttcaatgtc
ctcaataataagcctgtgtcccttggccaggcattggaagttgtcattcagttacaagag
aagcatgtcaaagatgagcagattgaacattggaagaagatagtgaaaactcaggaagaa
ttgaaagaacttcttaataagatggtaaatttgaaagagaaaattaaagaactccatcag
caatacaaagaagcatctgaagtaaagccacccagagatattactgccgagttcttagtg
aaaagcaaacacagggatctgaccgccctatgcaaggaatatgatgaattagctgaaaca
caaggaaagctagaagaaaaacttcaggagttggaagcgaatcccccaagtgatgtatat
ctctcatcaagagacagacaaatacttgattggcattttgcaaatcttgaatttgctaat
gccacacctctctcaactctctcccttaagcactgggatcaggatgatgactttgagttc
actggcagccacctgacagtaaggaatggctactcgtgtgtgcctgtggctttagcagaa
ggcctagacattaaactgaatacagcagtgcgacaggttcgctacacggcttcaggatgt
gaagtgatagctgtgaatacccgctccacgagtcaaacctttatttataaatgcgacgca
gttctctgtacccttcccctgggtgtgctgaagcagcagccaccagccgttcagtttgtg
ccacctctccctgagtggaaaacatctgcagtccaaaggatgggatttggcaaccttaac
aaggtggtgttgtgttttgatcgggtgttctgggatccaagtgtcaatttgttcgggcat
gttggcagtacgactgccagcaggggtgagctcttcctcttctggaacctctataaagct
ccaatactgttggcactagtggcaggagaagctgctggtatcatggaaaacataagtgac
gatgtgattgttggccgatgcctggccattctcaaagggatttttggtagcagtgcagta
cctcagcccaaagaaactgtggtgtctcgttggcgtgctgatccctgggctcggggctct
tattcctatgttgctgcaggatcatctggaaatgactatgatttaatggctcagccaatc
actcctggcccctcgattccaggtgccccacagccgattccacgactcttctttgcggga
gaacatacgatccgtaactacccagccacagtgcatggtgctctgctgagtgggctgcga
gaagcgggaagaattgcagaccagtttttgggggccatgtatacgctgcctcgccaggcc
acaccaggtgttcctgcacagcagtccccaagcatgtga

DBGET integrated database retrieval system