KEGG   Homo sapiens (human): 23030
Entry
23030             CDS       T01001                                 

Gene name
KDM4B, JMJD2B, TDRD14B
Definition
(RefSeq) lysine demethylase 4B
  KO
K06709  [histone H3]-trimethyl-L-lysine9/36 demethylase [EC:1.14.11.66 1.14.11.69]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23030 (KDM4B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.66  [histone H3]-trimethyl-L-lysine9 demethylase
     23030 (KDM4B)
    1.14.11.69  [histone H3]-trimethyl-L-lysine36 demethylase
     23030 (KDM4B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    23030 (KDM4B)
SSDB
Motif
Pfam: JmjC zf-HC5HC2H_2 Tudor_2 zf-HC5HC2H JmjN PHD_2 LBR_tudor PHD DUF4537
Other DBs
NCBI-GeneID: 23030
NCBI-ProteinID: NP_055830
OMIM: 609765
HGNC: 29136
Ensembl: ENSG00000127663
Vega: OTTHUMG00000180281
Pharos: O94953(Tbio)
UniProt: O94953 A0A0C4DFL8
Structure
PDB: 
4LXL 4UC4

Position
19p13.3
AA seq 1096 aa
MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTY
DDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLER
KYWKNLTFVSPIYGADISGSLYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLR
HKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDY
GKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTALTSPELSSWSA
SRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSVKEEAGPEVDPEE
EEEEPQPLPHGREAEGAEEDGRGKLRPTKAKSERKKKSFGLLPPQLPPPPAHFPSEEALW
LPSPLEPPVLGPGPAAMEESPLPAPLNVVPPEVPSEELEAKPRPIIPMLYVVPRPGKAAF
NQEHVSCQQAFEHFAQKGPTWKEPVSPMELTGPEDGAASSGAGRMETKARAGEGQAPSTF
SKLKMEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEASPFSGEEDVSDPDALRPLLSLQW
KNRAASFQAERKFNAAAARTEPYCAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKS
RQKTRPLIPEMCFTSGGENTEPLPANSYIGDDGTSPLIACGKCCLQVHASCYGIRPELVN
EGWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEARFLNVIERHPVDI
SAIPEQRWKLKCVYCRKRMKKVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVS
ITCLKHKSGGHAVQLLRAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDN
LYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKR
GDIFTLEEELPKRVRSRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVA
FVESLLQVQGRPGAPF
NT seq 3291 nt   +upstreamnt  +downstreamnt
atggggtctgaggaccacggcgcccagaaccccagctgtaaaatcatgacgtttcgccca
accatggaagaatttaaagacttcaacaaatacgtggcctacatagagtcgcagggagcc
caccgggcgggcctggccaagatcatccccccgaaggagtggaagccgcggcagacgtat
gatgacatcgacgacgtggtgatcccggcgcccatccagcaggtggtgacgggccagtcg
ggcctcttcacgcagtacaatatccagaagaaggccatgacagtgggcgagtaccgccgc
ctggccaacagcgagaagtactgtaccccgcggcaccaggactttgatgaccttgaacgc
aaatactggaagaacctcacctttgtctccccgatctacggggctgacatcagcggctct
ttgtatgatgacgacgtggcccagtggaacatcgggagcctccggaccatcctggacatg
gtggagcgcgagtgcggcaccatcatcgagggcgtgaacacgccctacctgtacttcggc
atgtggaagaccaccttcgcctggcacaccgaggacatggacctgtacagcatcaactac
ctgcactttggggagcctaagtcctggtacgccatcccaccagagcacggcaagcgcctg
gagcggctggccatcggcttcttccccgggagctcgcagggctgcgacgccttcctgcgg
cataagatgaccctcatctcgcccatcatcctgaagaagtacgggatccccttcagccgg
atcacgcaggaggccggggaattcatgatcacatttccctacggctaccacgccggcttc
aatcacgggttcaactgcgcagaatctaccaacttcgccaccctgcggtggattgactac
ggcaaagtggccactcagtgcacgtgccggaaggacatggtcaagatctccatggacgtg
ttcgtgcgcatcctgcagcccgagcgctacgagctgtggaagcagggcaaggacctcacg
gtgctggaccacacgcggcccacggcgctcaccagccccgagctgagctcctggagtgca
tcccgggcctcgctgaaggccaagctcctccgcaggtctcaccggaaacggagccagccc
aagaagccgaagcccgaagaccccaagttccctggggagggtacggctggggcagcgctc
ctagaggaggctgggggcagcgtgaaggaggaggctgggccggaggttgaccccgaggag
gaggaggaggagccgcagccactgccacacggccgggaggccgagggcgcagaagaggac
gggaggggcaagctgcggccaaccaaggccaagagcgagcggaagaagaagagcttcggc
ctgctgcccccacagctgccgcccccgcctgctcacttcccctcagaggaggcgctgtgg
ctgccatccccactggagcccccggtgctgggcccaggccctgcagccatggaggagagc
cccctgccggcaccccttaatgtcgtgccccctgaggtgcccagtgaggagctagaggcc
aagcctcggcccatcatccccatgctgtacgtggtgccgcggccgggcaaggcagccttc
aaccaggagcacgtgtcctgccagcaggcctttgagcactttgcccagaagggtccgacc
tggaaggaaccagtttcccccatggagctgacggggccagaggacggtgcagccagcagt
ggggcaggtcgcatggagaccaaagcccgggccggagaggggcaggcaccgtccacattt
tccaaattgaagatggagatcaagaagagccggcgccatcccctgggccggccgcccacc
cggtccccactgtcggtggtgaagcaggaggcctcaagtgacgaggaggcatcccctttc
tccggggaggaagatgtgagtgacccggacgccttgaggccgctgctgtctctgcagtgg
aagaacagggcggccagcttccaggccgagaggaagttcaacgcagcggctgcgcgcacg
gagccctactgcgccatctgcacgctcttctacccctactgccaggccctacagactgag
aaggaggcacccatagcctccctcggagagggctgcccggccacattaccctccaaaagc
cgtcagaagacccgaccgctcatccctgagatgtgcttcacctctggcggtgagaacacg
gagccgctgcctgccaactcctacatcggcgacgacgggaccagccccctgatcgcctgc
ggcaagtgctgcctgcaggtccatgccagttgctatggcatccgtcccgagctggtcaat
gaaggctggacgtgttcccggtgcgcggcccacgcctggactgcggagtgctgcctgtgc
aacctgcgaggaggtgcgctgcagatgaccaccgataggaggtggatccacgtgatctgt
gccatcgcagtccccgaggcgcgcttcctgaacgtgattgagcgccaccctgtggacatc
agcgccatccccgagcagcggtggaagctgaaatgcgtgtactgccggaagcggatgaag
aaggtgtcaggtgcctgtatccagtgctcctacgagcactgctccacgtccttccacgtg
acctgcgcccacgccgcaggcgtgctcatggagccggacgactggccctatgtggtctcc
atcacctgcctcaagcacaagtcggggggtcacgctgtccaactcctgagggccgtgtcc
ctaggccaggtggtcatcaccaagaaccgcaacgggctgtactaccgctgtcgcgtcatc
ggtgccgcctcgcagacctgctacgaagtgaacttcgacgatggctcctacagcgacaac
ctgtaccctgagagcatcacgagtagggactgtgtccagctgggacccccttccgagggg
gagctggtggagctccggtggactgacggcaacctctacaaggccaagttcatctcctcc
gtcaccagccacatctaccaggtggagtttgaggacgggtcccagctgacggtgaagcgt
ggggacatcttcaccctggaggaggagctgcccaagagggtccgctctcggctgtcactg
agcacgggggcaccgcaggagcccgccttctcgggggaggaggccaaggccgccaagcgc
ccgcgtgtgggcaccccgcttgccacggaggactccgggcggagccaggactacgtggcc
ttcgtggagagcctcctgcaggtgcagggccggcccggagcccccttctag

DBGET integrated database retrieval system