KEGG   Homo sapiens (human): 23036
Entry
23036             CDS       T01001                                 
Symbol
ZNF292, MRD63, MRD64, Nbla00365, ZFP292, ZN-16, Zn-15, bA393I2.3
Name
(RefSeq) zinc finger protein 292
Organism
hsa  Homo sapiens (human)
Disease
H00773  Autosomal dominant intellectual developmental disorder
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-C2H2_6 zinc_ribbon_11 zf-H2C2_2 zf-C2H2_jaz
Other DBs
NCBI-GeneID: 23036
NCBI-ProteinID: NP_055836
OMIM: 616213
HGNC: 18410
Ensembl: ENSG00000188994
Pharos: O60281(Tbio)
UniProt: O60281
Structure
Position
6:87155565..87265943
AA seq 2723 aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQTLLE
YAEKWKTSEDPLPLLEVYTVAIQSYVKARPYLTSECENVALVLERLALSCVELLLCLPVE
LSDKQWEQFQTLVQVAHEKLMENGSCELHFLATLAQETGVWKNPVLCTILSQEPLDKDKV
NEFLAFEGPILLDMRIKHLIKTNQLSQATALAKLCSDHPEIGIKGSFKQTYLVCLCTSSP
NGKLIEEISEVDCKDALEMICNLESEGDEKSALVLCTAFLSRQLQQGDMYCAWELTLFWS
KLQQRVEPSIQVYLERCRQLSLLTKTVYHIFFLIKVINSETEGAGLATCIELCVKALRLE
STENTEVKISICKTISCLLPDDLEVKRACQLSEFLIEPTVDAYYAVEMLYNQPDQKYDEE
NLPIPNSLRCELLLVLKTQWPFDPEFWDWKTLKRQCLALMGEEASIVSSIDELNDSEVYE
KVVDYQEESKETSMNGLSGGVGANSGLLKDIGDEKQKKREIKQLRERGFISARFRNWQAY
MQYCVLCDKEFLGHRIVRHAQKHYKDGIYSCPICAKNFNSKETFVPHVTLHVKQSSKERL
AAMKPLRRLGRPPKITTTNENQKTNTVAKQEQRPIKKNSLYSTDFIVFNDNDGSDDENDD
KDKSYEPEVIPVQKPVPVNEFNCPVTFCKKGFKYFKNLIAHVKGHKDNEDAKRFLEMQSK
KVICQYCRRHFVSVTHLNDHLQMHCGSKPYICIQMKCKAGFNSYAELLTHRKEHQVFRAK
CMFPKCGRIFSEAYLLYDHEAQHYNTYTCKFTGCGKVYRSQGELEKHLDDHSTPPEKVLP
PEAQLNSSGDSIQPSEVNQNTAENIEKERSMLPSENNIENSLLADRSDAWDKSKAESAVT
KQDQISASELRQANGPLSNGLENPATTPLLQSSEVAVSIKVSLNQGIEDNFGKQENSTVE
GSGEALVTDLHTPVEDTCNDLCHPGFQERKEQDCFNDAHVTQNSLVNSETLKIGDLTPQN
LERQVNNLMTFSVQNQAAFQNNLPTSKFECGDNVKTSSNLYNLPLKTLESIAFVPPQSDL
SNSLGTPSVPPKAPVQKFSCQVEGCTRTYNSSQSIGKHMKTAHPDQYAAFKMQRKSKKGQ
KANNLNTPNNGKFVYFLPSPVNSSNPFFTSQTKANGNPACSAQLQHVSPPIFPAHLASVS
TPLLSSMESVINPNITSQDKNEQGGMLCSQMENLPSTALPAQMEDLTKTVLPLNIDSGSD
PFLPLPAESSSMSLFPSPADSGTNSVFSQLENNTNHYSSQIEGNTNSSFLKGGNGENAVF
PSQVNVANNFSSTNAQQSAPEKVKKDRGRGPNGKERKPKHNKRAKWPAIIRDGKFICSRC
YRAFTNPRSLGGHLSKRSYCKPLDGAEIAQELLQSNGQPSLLASMILSTNAVNLQQPQQS
TFNPEACFKDPSFLQLLAENRSPAFLPNTFPRSGVTNFNTSVSQEGSEIIKQALETAGIP
STFEGAEMLSHVSTGCVSDASQVNATVMPNPTVPPLLHTVCHPNTLLTNQNRTSNSKTSS
IEECSSLPVFPTNDLLLKTVENGLCSSSFPNSGGPSQNFTSNSSRVSVISGPQNTRSSHL
NKKGNSASKRRKKVAPPLIAPNASQNLVTSDLTTMGLIAKSVEIPTTNLHSNVIPTCEPQ
SLVENLTQKLNNVNNQLFMTDVKENFKTSLESHTVLAPLTLKTENGDSQMMALNSCTTSI
NSDLQISEDNVIQNFEKTLEIIKTAMNSQILEVKSGSQGAGETSQNAQINYNIQLPSVNT
VQNNKLPDSSPFSSFISVMPTKSNIPQSEVSHKEDQIQEILEGLQKLKLENDLSTPASQC
VLINTSVTLTPTPVKSTADITVIQPVSEMINIQFNDKVNKPFVCQNQGCNYSAMTKDALF
KHYGKIHQYTPEMILEIKKNQLKFAPFKCVVPTCTKTFTRNSNLRAHCQLVHHFTTEEMV
KLKIKRPYGRKSQSENVPASRSTQVKKQLAMTEENKKESQPALELRAETQNTHSNVAVIP
EKQLVEKKSPDKTESSLQVITVTSEQCNTNALTNTQTKGRKIRRHKKEKEEKKRKKPVSQ
SLEFPTRYSPYRPYRCVHQGCFAAFTIQQNLILHYQAVHKSDLPAFSAEVEEESEAGKES
EETETKQTLKEFRCQVSDCSRIFQAITGLIQHYMKLHEMTPEEIESMTASVDVGKFPCDQ
LECKSSFTTYLNYVVHLEADHGIGLRASKTEEDGVYKCDCEGCDRIYATRSNLLRHIFNK
HNDKHKAHLIRPRRLTPGQENMSSKANQEKSKSKHRGTKHSRCGKEGIKMPKTKRKKKNN
LENKNAKIVQIEENKPYSLKRGKHVYSIKARNDALSECTSRFVTQYPCMIKGCTSVVTSE
SNIIRHYKCHKLSKAFTSQHRNLLIVFKRCCNSQVKETSEQEGAKNDVKDSDTCVSESND
NSRTTATVSQKEVEKNEKDEMDELTELFITKLINEDSTSVETQANTSSNVSNDFQEDNLC
QSERQKASNLKRVNKEKNVSQNKKRKVEKAEPASAAELSSVRKEEETAVAIQTIEEHPAS
FDWSSFKPMGFEVSFLKFLEESAVKQKKNTDKDHPNTGNKKGSHSNSRKNIDKTAVTSGN
HVCPCKESETFVQFANPSQLQCSDNVKIVLDKNLKDCTELVLKQLQEMKPTVSLKKLEVH
SNDPDMSVMKDISIGKATGRGQY
NT seq 8172 nt   +upstreamnt  +downstreamnt
atggcggacgaagaggccgagcaggagaggttgagttgcggcgaaggcggctgcgtcgcg
gagctgcagcgcctgggcgagcggctccaggagctggagctacagctgcgggagagccgg
gtaccggccgtggaagcggccaccgactactgtcagcagctgtgccagacactcctagaa
tatgcagagaaatggaaaacttcagaagatcctttacctttattggaggtatacacagtg
gctatccaaagttatgttaaagcccgaccttatcttacctctgaatgtgaaaatgtagcc
ttggttctggaacgcttggcattaagctgtgttgaacttttactgtgtctgcctgttgag
ttatcagataaacagtgggaacaatttcagacactggtgcaggtagctcatgaaaagctg
atggagaatggcagctgtgaattgcattttttagctactctagctcaagagactggggtg
tggaaaaacccggtactgtgcactattctttcccaggaaccattggataaggataaagtg
aatgaatttttagcttttgagggtcccatcttgttggatatgagaattaaacatctaatc
aaaacaaatcagttaagtcaagcaactgctctagcaaagctgtgttctgaccatccagag
attggcataaaaggtagttttaagcaaacttaccttgtctgtctttgtacatcatcacca
aatggaaagttaatcgaagagatttcagaagttgattgcaaagatgcactggaaatgatc
tgtaacttagaatctgagggtgatgaaaaaagcgctcttgttttatgtactgcgtttttg
tcacgtcagctccaacaaggagatatgtactgcgcttgggaacttactctcttttggagt
aaattacaacaaagagtagaaccatctatacaagtgtaccttgagaggtgtcgtcaactt
tctttgttaacgaaaacagtatatcacattttcttcctgattaaagttattaattcagag
actgaaggggctggacttgctacctgtatagaactgtgtgtaaaggctcttcgcttggag
tctacagaaaatactgaagtgaaaatatctatttgcaagaccatttcatgtttgttgcct
gatgatctggaagttaaacgtgcttgtcaactgagtgaatttcttattgagcctacagta
gatgcgtattatgctgtggaaatgttgtataatcagccagaccagaaatatgatgaagag
aatcttccaataccaaattctttacgctgtgagctgttacttgtattgaaaactcaatgg
ccctttgatccagaattctgggattggaaaaccttgaaacgacaatgtcttgcattaatg
ggagaagaagcatccattgtgtcttcaatagatgaactaaatgacagtgaagtatatgaa
aaagtggtagactaccaagaagagagtaaagaaacttctatgaatgggctttctggtgga
gttggtgctaattctggccttcttaaagacattggtgatgaaaagcagaagaagagagag
ataaaacagttaagagagaggggatttatatctgctcggtttaggaattggcaagcctac
atgcagtattgtgtgttgtgtgacaaagaattccttggtcacagaatagtacgacatgct
cagaaacattacaaagatggaatttatagttgccccatatgtgcaaagaactttaattct
aaagaaacttttgtccctcatgtcacactgcatgttaaacaatctagtaaagagagacta
gcagctatgaaaccattaagaagattgggaaggcctccaaagatcacaactaccaatgaa
aatcagaagactaatactgtggctaaacaggagcagcgacctataaaaaagaatagtctc
tattcaacagattttatagtgtttaatgacaatgatggttcagatgatgagaatgatgac
aaagataaatcctatgagccagaagtgattccagtccagaaaccagtacctgttaatgaa
tttaattgccctgtaactttttgtaaaaagggctttaagtactttaaaaatttaattgct
catgtgaaggggcataaagataatgaagacgccaagcgctttcttgaaatgcagagcaaa
aaagttatttgccagtactgtaggcggcattttgtgagtgttactcatctcaatgatcac
ttacagatgcactgtggcagtaaaccatatatctgtatacagatgaaatgtaaagctggt
tttaatagttacgccgagcttttaacccaccgaaaggagcatcaagtctttagagcaaaa
tgtatgtttcctaaatgtggaagaattttttcggaagcttatttactatatgatcatgaa
gcacaacattataatacgtacacttgtaagttcacaggttgtggtaaagtttatcgttct
cagggtgagctggaaaagcatctggatgatcacagtactcctcctgaaaaagtgctgcct
cctgaagcccaacttaattcatctggagattccattcagccttctgaagtgaatcagaac
acagcagagaatattgagaaagaaagatctatgcttccttcagaaaataacattgaaaac
agcttactagcagatagaagtgatgcttgggataaaagcaaagcagaatcagctgtgacc
aaacaagaccagatttctgcctctgagctcaggcaagctaatggaccattgtcaaatggt
ttggaaaaccctgctactactcctctacttcaatccagtgaagtagctgtgtccattaag
gtgtctctcaatcaggggattgaggataactttggaaagcaagaaaactcaactgtggaa
ggcagtggtgaagcactggtcacagacttacatacgccagttgaagatacttgtaatgat
ttgtgtcatccaggtttccaggagagaaaagaacaagattgctttaatgatgcccatgtt
actcagaattctttagtaaattcagaaactctcaaaataggtgaccttaccccacaaaac
ttagaaagacaagtgaacaacttgatgaccttttctgtgcaaaatcaggcagcatttcaa
aacaatttaccaacttccaaatttgaatgtggagataatgttaaaacatcatccaatctt
tataatttacctcttaagacattagaaagtattgcatttgttccaccgcagtccgaccta
agtaattcattaggaactccatcagtgcctccaaaagctccagttcagaaattcagctgc
caggtcgagggatgtactcgaacctataattcttcacagagtattgggaaacacatgaag
acagcacaccctgaccaatatgctgcatttaaaatgcagcgcaaaagtaaaaaaggtcag
aaagctaacaacttaaatacaccaaataatggaaagtttgtttattttttgccatcaccg
gtgaacagctcaaatccattttttacatcacagaccaaagccaatgggaatcctgcttgt
tcggcccagttgcagcatgtctcgccacccatttttccagctcatttagcaagtgtgtca
actccattgttgtcctcaatggaaagtgtcataaatccaaatataacttctcaggataaa
aatgaacaaggtggtatgttatgttcccaaatggaaaatttacctagtactgccttgcca
gcacaaatggaagatctaaccaaaacagttctgcctttgaatattgacagtggctcagat
cctttccttcctttacctgcagaaagtagttcaatgtctctcttcccttcaccagcagat
agtgggactaattctgttttttcccaactggaaaataatacaaatcattattcctcacag
attgaaggaaacactaattcctcctttctaaaggggggtaatggtgaaaatgcagttttt
ccttcacaagtgaatgttgcaaataacttcagtagcaccaatgcccaacagtctgcacct
gaaaaagttaaaaaagaccgtgggcggggcccaaatgggaaggaaagaaaacctaagcac
aacaaaagggctaaatggcctgcaattatcagagatgggaaatttatctgtagcaggtgt
tacagggcttttactaatcccagatcactgggtgggcacttatccaagcgatcttactgt
aaaccactggatggagccgaaattgctcaagaacttctacagagtaatggacagccttct
cttcttgccagcatgattctctccacaaatgcagtaaatttgcagcagccacaacaatct
accttcaatccagaagcatgttttaaagatccatcatttctacagcttcttgctgaaaat
cgctcgccagcatttttaccaaatacatttcctcgatctggtgtgactaactttaatacc
agtgtcagtcaagaaggtagtgaaattattaaacaggctttggaaactgctggcattccc
agtacatttgagggtgccgaaatgctttctcatgtttcaacaggttgtgtctctgatgca
tcacaagtaaatgcaacggtgatgccaaatccaactgtaccacccctgttgcacactgta
tgccatccaaacaccttgctgaccaaccagaataggacgtcaaactccaaaacttcctcc
attgaggaatgtagcagcttgcctgtttttccaacgaatgacttactactgaagactgtt
gaaaatggtttgtgctctagttcatttcctaattctggtgggccatcacaaaattttacc
agtaacagttctcgtgtttctgttataagtggtcctcagaacacaagatccagtcattta
aataaaaagggaaacagtgcttctaagagaagaaagaaagttgctcctccactaattgca
cctaacgcttcccaaaacttggtaacaagtgacttaacaacaatgggactcatagcaaag
agtgttgaaatcccaactactaaccttcattcaaatgtaattccaacttgtgaacctcag
agtttggtggaaaatctaacacagaaattaaataatgttaacaatcagttatttatgact
gatgtaaaagagaatttcaaaaccagtcttgagtcccatacagtgttagcccctttaaca
ttaaaaactgaaaatggtgattcccaaatgatggctttgaattcatgcacaacttcaata
aattctgatttgcagatttctgaagacaatgttatacaaaactttgaaaagactcttgaa
attattaaaactgctatgaattctcaaatacttgaggtaaaaagtggatctcagggtgct
ggtgaaacttcacaaaatgctcaaataaattataacattcagcttccttcagtaaacact
gtgcaaaataacaaattacccgattcttctccgttttcctcctttataagtgtcatgcca
acaaaaagtaacattcctcagtctgaagtatcacataaggaggatcaaatacaggaaatt
ttagaaggcttacagaaattaaaattagaaaatgacctatccactccagcatcccaatgt
gtactgataaatacatcagtgacactgactcccacgcctgttaaatcaactgcagatatc
acagttattcagccagtttctgaaatgataaacattcaatttaatgacaaagttaataaa
ccctttgtgtgtcaaaaccaaggctgtaactacagtgctatgacaaaggatgcactattt
aagcactatggtaaaattcatcaatacactccagaaatgattcttgaaattaagaagaat
caattgaaatttgctccctttaaatgtgtagtacctacatgtacaaaaacatttacaaga
aattctaacctccgggcacactgtcagttggtgcatcattttacaactgaagaaatggta
aagttaaaaattaaaaggccttatggaagaaaatctcagagtgaaaatgtgccggcctca
cgaagtacacaagtgaaaaaacagctagctatgacagaggaaaataaaaaggaatctcag
cctgctttagaattgagagcagagacccaaaatacccacagtaatgtagcagtgatccca
gaaaaacaacttgtagaaaaaaaaagtcctgacaaaacagaaagttctttacaagtgatt
acagttacttcagaacaatgtaatacaaatgcactcacaaacacacaaaccaaaggacgg
aagattaggaggcataaaaaagaaaaggaggagaaaaaacgaaagaagccagtttcccaa
tcccttgagtttccaacaagatacagtccttacagaccttatcgatgtgttcaccaggga
tgctttgctgcctttacgatacagcaaaacttgattctccattaccaggctgtacacaaa
tcagatctacctgcattttcagcagaggtcgaagaggaaagtgaagctggtaaagaaagt
gaagaaactgaaactaaacaaactttgaaagaatttcgatgtcaggtaagtgactgttct
cgaattttccaagcaattactggcctaatacaacactacatgaaacttcatgaaatgact
cctgaagaaattgaaagtatgactgcttcagtggatgttgggaagtttccatgtgaccag
ttagagtgtaaatcttcatttactacatatttgaactatgttgttcatctagaggcagac
cacgggattggactaagggcaagtaaaacagaagaagatggtgtatacaaatgtgattgt
gaaggctgtgaccgtatatatgcaacccggtcgaatctcctccgacacatttttaataag
cataatgacaaacataaggctcatttgattcgtccaagaagattaacaccaggccaggaa
aatatgtcaagcaaggcaaaccaagaaaaatcaaagtctaaacatcgggggaccaagcac
agcagatgtggaaaggaaggaataaaaatgcccaagaccaaacgaaagaaaaaaaataat
ttagaaaacaagaatgcaaagattgtgcagattgaagaaaataagccttattctctgaaa
cgtgggaagcatgtatattctataaaggctagaaatgatgccctgtctgagtgtacaagc
agatttgtaacccagtatccatgtatgataaagggatgtacttcagttgttacaagtgaa
agcaatataattagacattataagtgccataaattatctaaggcatttacatcacaacac
cgaaatcttcttattgtattcaaacggtgttgcaactcacaagtaaaggaaacgtctgag
caagaaggtgctaagaatgatgtgaaagattctgacacgtgtgtatcagagagcaatgat
aattcaagaacaacagctacagtttcacaaaaggaagttgaaaaaaatgaaaaagatgaa
atggatgaactaacagaattgtttattacaaaattaataaatgaagatagcacaagtgta
gagacccaagctaatacttcttcaaatgtaagtaatgattttcaggaagataacctctgc
cagtcagaaagacaaaaagcaagtaatttgaagagagttaataaggaaaaaaatgtctca
caaaataaaaaaaggaaagttgaaaaagctgaaccagcatcagcagctgagttaagtagc
gtgcgtaaagaagaagaaactgctgttgccattcaaaccattgaggagcatcctgcatct
tttgactggagctcttttaagccaatgggatttgaagtatcatttctgaagtttcttgag
gagtctgcagtgaagcagaagaaaaatactgacaaagaccatccgaatactggaaacaaa
aaaggatcccattcaaattcaagaaaaaatattgataagactgctgtgactagtggaaat
catgtatgtccttgtaaagaaagcgaaacgtttgtacagtttgccaatccatcacagctt
cagtgcagtgataatgtaaaaattgttttagacaagaatcttaaagattgcactgagctt
gtcttaaagcaacttcaggaaatgaaacctaccgtcagtctgaaaaaacttgaagtacat
tcaaatgatccagatatgtctgttatgaaagatatcagtataggtaaagccacaggcaga
ggtcagtactga

DBGET integrated database retrieval system