KEGG   Homo sapiens (human): 23054Help
Entry
23054             CDS       T01001                                 

Gene name
NCOA6, AIB3, ASC2, NRC, PRIP, RAP250, TRBP
Definition
(RefSeq) nuclear receptor coactivator 6
  KO
K14971  nuclear receptor coactivator 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23054 (NCOA6)
   03036 Chromosome and associated proteins [BR:hsa03036]
    23054 (NCOA6)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Others
    23054 (NCOA6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    MLL3/MLL4 complex
     23054 (NCOA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleic_acid_bd
Motif
Other DBs
NCBI-GeneID: 23054
NCBI-ProteinID: NP_001305169
OMIM: 605299
HGNC: 15936
Ensembl: ENSG00000198646
Vega: OTTHUMG00000032311
Pharos: Q14686(Tbio)
UniProt: Q14686
Position
20q11.22
AA seq 2063 aa AA seqDB search
MVLDDLPNLEDIYTSLCSSTMEDSEMDFDSGLEDDDTKSDSILEDSTIFVAFKGNIDDKD
FKWKLDAILKNVPNLLHMESSKLKVQKVEPWNSVRVTFNIPREAAERLRILAQSNNQQLR
DLGILSVQIEGEGAINLALAQNRSQDVRMNGPMGAGNSVRMEAGFPMASGPGIIRMNNPA
TVMIPPGGNVSSSMMAPGPNPELQPRTPRPASQSDAMDPLLSGLHIQQQSHPSGSLAPPH
HPMQPVSVNRQMNPANFPQLQQQQQQQQQQQQQQQQQQQQQQQQQLQARPPQQHQQQQPQ
GIRPQFTAPTQVPVPPGWNQLPSGALQPPPAQGSLGTMTANQGWKKAPLPGPMQQQLQAR
PSLATVQTPSHPPPPYPFGSQQASQAHTNFPQMSNPGQFTAPQMKSLQGGPSRVPTPLQQ
PHLTNKSPASSPSSFQQGSPASSPTVNQTQQQMGPRPPQNNPLPQGFQQPVSSPGRNPMV
QQGNVPPNFMVMQQQPPNQGPQSLHPGLGGMPKRLPPGFSAGQANPNFMQGQVPSTTATT
PGNSGAPQLQANQNVQHAGGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSG
VPQVNLSNMQGQPQQGPPSQLMGMHQQIVPSQGQMVQQQGTLNPQNPMILSRAQLMPQGQ
MMVNPPSQNLGPSPQRMTPPKQMLSQQGPQMMAPHNQMMGPQGQVLLQQNPMIEQIMTNQ
MQGNKQQFNTQNQSNVMPGPAQIMRGPTPNMQGNMVQFTGQMSGQMLPQQGPVNNSPSQV
MGIQGQVLRPPGPSPHMAQQHGDPATTANNDVSLSQMMPDVSIQQTNMVPPHVQAMQGNS
ASGNHFSGHGMSFNAPFSGAPNGNQMSCGQNPGFPVNKDVTLTSPLLVNLLQSDISAGHF
GVNNKQNNTNANKPKKKKPPRKKKNSQQDLNTPDTRPAGLEEADQPPLPGEQGINLDNSG
PKLPEFSNRPPGYPSQPVEQRPLQQMPPQLMQHVAPPPQPPQQQPQPQLPQQQQPPPPSQ
PQSQQQQQQQQQMMMMLMMQQDPKSVRLPVSQNVHPPRGPLNPDSQRMPMQQSGSVPVMV
SLQGPASVPPSPDKQRMPMPVNTPLGSNSRKMVYQESPQNPSSSPLAEMASLPEASGSEA
PSVPGGPNNMPSHVVLPQNQLMMTGPKPGPSPLSATQGATPQQPPVNSLPSSHGHHFPNV
AAPTQTSRPKTPNRASPRPYYPQTPNNRPPSTEPSEISLSPERLNASIAGLFPPQINIPL
PPRPNLNRGFDQQGLNPTTLKAIGQAPSNLTMNPSNFATPQTHKLDSVVVNSGKQSNSGA
TKRASPSNSRRSSPGSSRKTTPSPGRQNSKAPKLTLASQTNAALLQNVELPRNVLVSPTP
LANPPVPGSFPNNSGLNPQNSTVSVAAVGGVVEDNKESLNVPQDSDCQNSQSRKEQVNIE
LKAVPAQEVKMVVPEDQSKKDGQPSDPNKLPSVEENKNLVSPAMREAPTSLSQLLDNSGA
PNVTIKPPGLTDLEVTPPVVSGEDLKKASVIPTLQDLSSSKEPSNSLNLPHSNELCSSLV
HPELSEVSSNVAPSIPPVMSRPVSSSSISTPLPPNQITVFVTSNPITTSANTSAALPTHL
QSALMSTVVTMPNAGSKVMVSEGQSAAQSNARPQFITPVFINSSSIIQVMKGSQPSTIPA
APLTTNSGLMPPSVAVVGPLHIPQNIKFSSAPVPPNALSSSPAPNIQTGRPLVLSSRATP
VQLPSPPCTSSPVVPSHPPVQQVKELNPDEASPQVNTSADQNTLPSSQSTTMVSPLLTNS
PGSSGNRRSPVSSSKGKGKVDKIGQILLTKACKKVTGSLEKGEEQYGADGETEGQGLDTT
APGLMGTEQLSTELDSKTPTPPAPTLLKMTSSPVGPGTASAGPSLPGGALPTSVRSIVTT
LVPSELISAVPTTKSNHGGIASESLAGGLVEEKVGSHPELLPSIAPSQNLVSKETSTTAL
QASVARPELEVNAAIVSGQSSEPKEIVEKSKIPGRRNSRTEEPTVASESVENGHRKRSSR
PASASSSTKDITSAVQSKRRKSK
NT seq 6192 nt NT seq  +upstreamnt  +downstreamnt
atggttttggatgaccttccaaacttagaagacatctatacttccttgtgttcatcaaca
atggaagactcagagatggattttgactctggactagaagatgatgacacaaaaagtgat
agtattttggaggattccacaatttttgtggccttcaaaggaaatatagatgataaagac
ttcaaatggaaattagatgcaatattgaaaaacgtgcccaatttgttacacatggagtcc
agcaagctaaaagtacagaaggtggagccctggaacagcgtgcgtgtgacattcaacatc
ccccgggaagcagcggagcggctacggatccttgctcagagcaacaaccagcagcttcgg
gatttagggattctctccgttcagattgaaggggaaggtgctattaacctggctttggct
cagaaccgaagccaagatgtgagaatgaatggacccatgggagctggaaattcagttagg
atggaggcgggatttcctatggcaagtggtccaggaataataaggatgaacaaccctgcc
actgttatgatacccccgggtggaaatgtgtcatcttccatgatggcaccaggccccaat
ccagagctgcagcccaggactcctcgccctgcttctcagtcagatgcaatggatccactc
ctctctgggctccatatacagcagcaaagtcatccctcaggatctttagctcccccacat
cacccaatgcagcctgtctctgtgaacagacaaatgaacccagctaattttccccagctg
cagcagcagcagcaacaacaacaacagcagcagcagcagcagcagcagcaacaacagcaa
cagcagcaacaacagttgcaggcaagacccccacagcaacatcagcagcaacagccacag
ggaattcgaccccagtttactgccccaactcaggtgcctgttcctccaggctggaaccag
ctgccttctggagcccttcaacctcctccagcccagggttctctgggcacaatgactgca
aaccaagggtggaagaaggctcccttgcccggcccaatgcaacagcaactccaggcaaga
ccatccttagccacggtacagacgccttcccaccctccccctccatatccctttggcagc
cagcaagcctcacaagcccacacaaactttcctcagatgagcaacccaggccagttcaca
gctcctcagatgaagagtttgcagggagggccctctagggtcccaactcccttgcagcag
ccccacctcaccaacaagtctcctgcctcctcaccctcctccttccagcagggatcccct
gcatcctccccaacggttaaccaaactcagcagcagatgggaccaaggccacctcaaaat
aacccacttccccagggatttcagcagcctgtcagctctccgggtcggaatcctatggtt
caacagggaaatgtgccacctaacttcatggtgatgcagcagcaaccaccaaaccagggg
ccacagagtttacatccaggcctaggaggaatgcctaaacgcctcccacctggcttctca
gcaggacaggccaatccgaactttatgcaaggtcaggtgccttcgaccacagcaaccacc
cctgggaattcaggagcccctcagctgcaagcaaatcaaaatgtccagcatgcaggtggt
caaggagctggtcctcctcaaaaccagatgcaggtgtcccacgggccgccaaatatgatg
cagcccagcctcatgggaattcatggcaacatgaacaatcagcaggctggtacttctggg
gttcctcaagtgaacctcagcaacatgcaaggccagccccagcagggcccaccatctcag
ctgatgggcatgcaccagcaaatcgtgccctcccagggccagatggtccagcaacaagga
accttgaaccctcagaaccctatgatcctttcaagggcccagcttatgccacagggccag
atgatggtgaaccccccgagccaaaatcttgggccctcgccccaaaggatgaccccaccc
aagcagatgctttcccagcagggcccacaaatgatggcgccacataaccagatgatgggg
cctcaggggcaggttttgctccaacagaacccaatgatagagcagattatgaccaatcaa
atgcaggggaataagcagcagtttaacactcagaaccagtccaatgtcatgccgggacca
gcccagataatgaggggaccaactccaaacatgcaaggaaatatggtgcagtttacggga
cagatgtcaggacagatgctgccccagcaagggcctgtgaacaacagtccatctcaggtt
atgggcattcagggacaggtcctgcggccaccagggcccagcccacacatggcccagcag
catggtgatcctgctactacagcaaataacgatgtcagtttatctcagatgatgcctgat
gttagcattcaacaaaccaacatggtcccccctcatgtgcaggccatgcagggaaacagt
gcctcgggaaaccacttctcaggccatgggatgtctttcaatgcacctttcagtggagct
cccaatggaaatcagatgtcctgtggtcaaaatccaggcttcccagtcaataaggatgtc
acgctaacgagcccattgttggtcaacttattgcagagtgacatatctgcaggccatttt
ggggtaaacaataagcaaaataataccaacgcaaataaaccgaagaagaagaaaccccct
cggaagaagaaaaatagtcagcaagatctaaacaccccagatactcgcccagctggtctg
gaagaggctgatcagccaccgttgcctggagaacaaggaattaacttggataactcaggc
cctaaactgccagaattttcaaaccggccaccaggttatccttctcaaccagttgaacag
aggccacttcagcagatgcctcctcaactcatgcagcatgtggcacccccaccacagcca
ccacagcagcagccacagccacaactgcctcagcagcagcagccaccacctcccagtcag
ccacagtctcagcagcagcagcagcagcagcaacaaatgatgatgatgctcatgatgcag
caggatcccaaatcagttaggcttccagtctctcaaaatgtccatcctccaaggggcccc
ctgaaccccgactcccagagaatgcccatgcaacagagtggcagtgtgcctgtcatggtc
agtctgcaaggacctgcctccgtgccaccatcacctgataaacaaagaatgccaatgcct
gtgaatactcccttgggaagcaattcaaggaaaatggtctatcaggagagcccgcagaat
ccttccagctcgccactggcggagatggcctcactccctgaagcaagtggcagtgaagca
ccatctgtcccaggaggcccaaacaacatgccttcacatgtagtacttccccagaatcag
ttaatgatgacagggccaaaacctggaccatcgcccctttcagcaactcaaggtgcaact
ccccagcaaccccctgtaaattccctgcccagctctcacggccaccacttcccaaatgtg
gctgcgccaacccagacatctaggcccaaaacaccaaacagagccagccccagaccctat
tatcctcagacacccaacaaccgccctcccagcacagaaccttcagaaatcagtctgtca
ccagaaagactcaatgcctccatagcaggactcttccctccacagattaatattccttta
cctcctaggccaaatttaaacaggggctttgatcaacaaggcctaaatccaacaactttg
aaggccatcgggcaagcaccttcaaatcttaccatgaatccttccaattttgctacccca
caaactcacaaattagattctgtggtagtgaattctggaaagcagtctaattctggagca
acaaaacgggcaagtccaagcaacagtcgcaggtctagtcctgggtccagtaggaaaacc
actccaagccctgggaggcaaaattcaaaagcccctaaacttactctggcctctcagaca
aatgcagccctattgcagaatgtggagttgccgagaaatgtattggtcagtcccactcct
ctggccaatccccctgtacctgggagctttcctaacaacagtgggctgaatcctcagaat
tctactgtgtctgtggctgcagttgggggtgttgttgaggataacaaggagagcttgaat
gtgcctcaggacagtgattgccagaattcccagagtaggaaggaacaggtaaacattgaa
ctaaaagcagtccctgcccaagaagttaaaatggttgtccctgaagatcagtccaaaaag
gatgggcagccttcggatcctaacaaacttcccagtgtcgaagagaacaaaaatttggtg
tctcctgctatgagggaagcaccaacatcgttaagtcaacttcttgacaactctggagct
cccaatgtgacaattaaaccccctgggcttacagatctggaagtaacacctccagtagtt
tctggggaggacctcaaaaaagcatctgtcattcccacactgcaggatctgtcttcttct
aaagaaccttctaattccctaaacttacctcacagtaatgagctgtgttcatcccttgtg
catcccgaattgagtgaggtcagttctaacgttgcaccaagcatccctccagtaatgtca
agacctgttagctcttcctccatttccactcccttgcccccaaatcaaataactgtattt
gtcacttccaatcccatcacaacttcagctaacacatcagcagctttgccaactcacttg
cagtctgcattgatgtcaacagttgtcacaatgcccaatgcgggtagcaaggttatggtt
tctgagggacagtcagctgctcagtctaatgcccggcctcagttcattacacctgtcttt
atcaattcatcctcaataattcaggttatgaaaggatcacagccaagcacaattcctgca
gccccactgacaaccaactctggcctgatgcctccctctgttgcagttgttggcccttta
cacatacctcagaacataaaattttcttctgctcctgtaccgcctaatgccctctccagt
agtcctgctccaaacatccagacaggtcgacctttggtccttagctcacgagccacccct
gttcagcttccttcccctccttgtacgtcttctccagttgtcccttctcatccccctgtg
cagcaagtgaaagaattgaatccagatgaggctagccctcaggtgaacacctcagcagat
cagaacactcttccctcttcacagtcaaccacaatggtttctccccttttgaccaatagt
ccagggtcctctggcaaccggcgaagcccagtctcgtctagtaagggcaaaggaaaagtg
gacaaaattggccaaattttgttgaccaaggcatgtaagaaagttacaggctctcttgag
aaaggggaagaacaatatggtgcagatggagagactgaaggccaagggctagacaccaca
gctccggggctcatgggaacagagcagttatccacagagctggacagtaaaaccccaacg
cccccagcacccactctgctaaaaatgacctctagccctgtgggcccgggcactgcctca
gcaggacccagcttacctggcggtgctctccccaccagtgtacgctcgatagtaaccact
ctggtaccctccgagctcatctccgccgtaccgaccacaaaaagcaatcatggtggcata
gcatctgagtcacttgcgggtggcctagtggaggagaaggtgggatcccatccagaactt
ctacccagcatagccccgtcgcagaatttagtctcaaaggaaacttcaaccacagcactg
caggcctctgttgccagaccagagctggaggtaaatgctgccatagtctctggacaaagc
agtgagcccaaagagatagttgaaaagtccaaaatcccaggccgaagaaactcccgaact
gaagagccaactgtggcctctgaaagtgtggaaaatggacatcgtaaacgatcttctcga
cctgcttcagcctccagctctactaaagacataaccagtgcggtgcaatccaagcgaaga
aaatccaagtaa

DBGET integrated database retrieval system