KEGG   Homo sapiens (human): 23057Help
Entry
23057             CDS       T01001                                 

Gene name
NMNAT2, C1orf15, PNAT2
Definition
(RefSeq) nicotinamide nucleotide adenylyltransferase 2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    23057 (NMNAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     23057 (NMNAT2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     23057 (NMNAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 23057
NCBI-ProteinID: NP_055854
OMIM: 608701
HGNC: 16789
Ensembl: ENSG00000157064
Vega: OTTHUMG00000035519
Pharos: Q9BZQ4(Tbio)
UniProt: Q9BZQ4
Position
1q25.3
AA seq 307 aa AA seqDB search
MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGL
VSSRHRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
SMTPVIGQPQNETPQPIYQNSNVATKPTAAKILGKVGESLSRICCVRPPVERFTFVDENA
NLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRI
MNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQ
LYINASG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccaccaagacccacgttatcttgctcgcctgcggcagcttcaatcccatc
accaaagggcacattcagatgtttgaaagagccagggattatctgcacaaaactggaagg
tttattgtgattggcgggattgtctcccctgtccacgactcctatggaaaacagggcctc
gtgtcaagccggcaccgtctcatcatgtgtcagctggccgtccagaattctgattggatc
agggtggacccttgggagtgctaccaggacacctggcagacgacctgcagcgtgttggaa
caccaccgggacctcatgaagagggtgactggctgcatcctctccaatgtcaacacacct
tccatgacacctgtgatcggacagccacaaaacgagaccccccagcccatttaccagaac
agcaacgtggccaccaagcccactgcagccaagatcttggggaaggtgggagaaagcctc
agccggatctgctgtgtccgcccgccggtggagcgtttcacctttgtagatgagaatgcc
aatctgggcacggtgatgcggtatgaagagattgagctacggatcctgctgctgtgtggt
agtgacctgctggagtccttctgcatcccagggctctggaacgaggcagatatggaggtg
attgttggtgactttgggattgtggtggtgccccgggatgcagccgacacagaccgaatc
atgaatcactcctcaatactccgcaaatacaaaaacaacatcatggtggtgaaggatgac
atcaaccatcccatgtctgttgtcagctcaaccaagagcaggctggccctgcagcatggg
gacggccatgttgtggattacctgtcccagccggtcatcgactacatcctcaaaagccag
ctgtacatcaatgcctccggctag

DBGET integrated database retrieval system