KEGG   Homo sapiens (human): 23063Help
Entry
23063             CDS       T01001                                 

Gene name
WAPL, FOE, KIAA0261, WAPAL
Definition
(RefSeq) WAPL cohesin release factor
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: WAPL
Motif
Other DBs
NCBI-GeneID: 23063
NCBI-ProteinID: NP_055860
OMIM: 610754
HGNC: 23293
Ensembl: ENSG00000062650
Vega: OTTHUMG00000018651
Pharos: Q7Z5K2(Tbio)
UniProt: Q7Z5K2 B2RTX8 A8K273
Structure
PDB: 

Position
10q23.2
AA seq 1190 aa AA seqDB search
MTSRFGKTYSRKGGNGSSKFDEVFSNKRTTLSTKWGETTFMAKLGQKRPNFKPDIQEIPK
KPKVEEESTGDPFGFDSDDESLPVSSKNLAQVKCSSYSESSEAAQLEEVTSVLEANSKIS
HVVVEDTVVSDKCFPLEDTLLGKEKSTNRIVEDDASISSCNKLITSDKVENFHEEHEKNS
HHIHKNADDSTKKPNAETTVASEIKETNDTWNSQFGKRPESPSEISPIKGSVRTGLFEWD
NDFEDIRSEDCILSLDSDPLLEMKDDDFKNRLENLNEAIEEDIVQSVLRPTNCRTYCRAN
KTKSSQGASNFDKLMDGTSQALAKANSESSKDGLNQAKKGGVSCGTSFRGTVGRTRDYTV
LHPSCLSVCNVTIQDTMERSMDEFTASTPADLGEAGRLRKKADIATSKTTTRFRPSNTKS
KKDVKLEFFGFEDHETGGDEGGSGSSNYKIKYFGFDDLSESEDDEDDDCQVERKTSKKRT
KTAPSPSLQPPPESNDNSQDSQSGTNNAENLDFTEDLPGVPESVKKPINKQGDKSKENTR
KIFSGPKRSPTKAVYNARHWNHPDSEELPGPPVVKPQSVTVRLSSKEPNQKDDGVFKAPA
PPSKVIKTVTIPTQPYQDIVTALKCRREDKELYTVVQHVKHFNDVVEFGENQEFTDDIEY
LLSGLKSTQPLNTRCLSVISLATKCAMPSFRMHLRAHGMVAMVFKTLDDSQHHQNLSLCT
AALMYILSRDRLNMDLDRASLDLMIRLLELEQDASSAKLLNEKDMNKIKEKIRRLCETVH
NKHLDLENITTGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVDKVKECVDHLSRDED
EEKLVASLWGAERCLRVLESVTVHNPENQSYLIAYKDSQLIVSSAKALQHCEELIQQYNR
AEDSICLADSKPLPHQNVTNHVGKAVEDCMRAIIGVLLNLTNDNEWGSTKTGEQDGLIGT
ALNCVLQVPKYLPQEQRFDIRVLGLGLLINLVEYSARNRHCLVNMETSCSFDSSICSGEG
DDSLRIGGQVHAVQALVQLFLERERAAQLAESKTDELIKDAPTTQHDKSGEWQETSGEIQ
WVSTEKTDGTEEKHKKEEEDEELDLNKALQHAGKHMEDCIVASYTALLLGCLCQESPINV
TTVREYLPEGDFSIMTEMLKKFLSFMNLTCAVGTTGQKSISRVIEYLEHC
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atgacatccagatttgggaaaacatacagtaggaaaggtggaaatggcagttcaaaattc
gatgaagtcttttccaacaaacggactacccttagcacaaaatggggagagaccacattt
atggctaaattagggcagaagaggcccaatttcaaaccagatatccaagaaattccgaag
aaacctaaagtggaagaagaaagtactggagatccttttggatttgatagtgatgatgag
tctctaccagtttcttcaaagaatttagcccaggttaagtgttcctcttattcagaatct
agtgaagctgctcagttggaagaggtcacttcagtacttgaagctaatagcaaaattagt
catgtggtcgttgaagacactgtcgtttctgataaatgcttccctttggaggacacttta
cttgggaaagaaaagagcacaaaccgaattgtagaagatgatgcaagcataagtagctgt
aataaattaataacttcagataaagtggagaattttcatgaagaacatgaaaagaatagt
caccatattcacaaaaatgctgatgacagtactaagaaacccaatgcagaaactacagtg
gcttctgaaatcaaggaaacaaatgatacttggaactcccagtttgggaaaaggccagaa
tcaccatcagaaatatctccaatcaagggatctgttagaactggtttgtttgaatgggat
aatgattttgaagatatcagatcagaagactgtattttaagtttggatagtgatcccctt
ttggagatgaaggatgacgattttaaaaatcgattggaaaatctgaatgaagccattgag
gaagatattgtacaaagtgttcttaggccaaccaactgtaggacgtactgtagggccaat
aaaacgaaatcctcccaaggagcatcaaattttgataagctgatggacggcaccagtcag
gccttagccaaagcaaacagtgaatcgagtaaagatggcctgaatcaggcaaagaaaggg
ggtgtaagttgtgggaccagttttagagggacagttggacggactagagattacactgtt
ttacatccatcttgcttgtcagtttgtaatgttaccatacaggatactatggaacgcagc
atggatgagttcactgcatccactcctgcagatttgggagaagctggtcgtctcagaaaa
aaggcagatattgcaacttctaagactactactagatttcgacctagtaatactaaatcc
aaaaaggatgttaaacttgaattttttggttttgaagatcatgagacaggaggtgatgaa
ggaggttctggaagttctaattacaaaattaagtattttggctttgatgatctcagtgaa
agcgaagatgatgaagatgatgactgtcaagtagaaagaaagacaagcaaaaaaagaact
aaaacagctccatcaccctccttgcagcctcccccagaaagcaatgataattcccaggac
agtcagtctggtactaacaatgcagaaaacttggattttacagaggacttgcctggtgtg
cctgaaagtgtgaagaagcccataaataaacaaggagataaatcaaaggaaaataccaga
aagatttttagtggccccaaacggtcacccacaaaagctgtatataatgccagacattgg
aatcatccagattcagaagaactgcctgggccaccagtagtaaaacctcagagtgtcaca
gtgaggctgtcttcaaaggaaccaaatcaaaaagatgatggagtttttaaggctcctgca
ccaccatccaaagtgataaaaactgtgacaatacctactcagccctaccaagatatagtt
actgcactgaaatgcagacgagaagacaaagaattatatactgttgttcagcacgtgaag
cacttcaacgatgttgtagaatttggtgaaaatcaagagttcactgatgacattgagtac
ttgttaagtggcttaaagagcactcagcctctaaacacacgttgccttagtgttattagc
ttggctactaaatgtgccatgcccagttttcgaatgcacctgagagcacatgggatggta
gcaatggtctttaaaaccttggatgattcccagcaccatcagaatctgtccctctgtaca
gctgccctcatgtatatactgagtagagatcgtttgaacatggatcttgatagagctagc
ttagatctaatgattcgacttttggaactggaacaagatgcttcatcagccaagctactg
aatgaaaaagacatgaacaaaattaaagaaaaaatccgaaggctctgtgaaactgtacac
aacaagcatcttgatctagaaaatataacgactgggcatttagctatggagacattatta
tcccttacttctaaacgagcaggagactggtttaaagaagaactccggcttttgggtggt
ctggatcatattgtagataaagtaaaagaatgtgtggatcatttaagtagagatgaggat
gaagagaaactggtagcctcactatggggagcagagagatgtttacgagttttagaaagt
gtaactgtgcataatcccgaaaatcaaagctacttgatagcatataaagattcccaactt
attgtttcatcagctaaagcattacagcattgtgaagaactgattcagcagtacaaccgt
gctgaggacagcatatgcttagctgacagtaagcctctgcctcaccagaatgtaactaac
catgtaggcaaagcagtggaggactgcatgagggccatcatcggggtgttgcttaattta
actaatgataatgagtggggcagcaccaaaacaggagagcaggacggtctcataggcaca
gcgctgaactgtgtgcttcaggttccaaagtacctacctcaggagcagagatttgatatt
cgagtgctgggcttaggtctgctgataaatctagtggagtatagtgctcggaatcggcac
tgtcttgtcaacatggaaacatcgtgctcttttgattcttccatctgtagtggagaaggg
gatgatagtttaaggataggtggacaagttcatgctgtccaggctttagtgcagctattc
cttgagcgagagcgggcagcccagctagcagaaagtaaaacagatgagttgatcaaagat
gctcccaccactcagcatgataagagtggagagtggcaagaaacaagtggagaaatacag
tgggtgtcaactgaaaagactgatggtacagaagagaaacataagaaggaggaggaggat
gaagaacttgacctcaataaagcccttcagcatgccggcaaacacatggaggattgcatt
gtggcctcctacacagcactacttcttgggtgtctctgccaggaaagtccaatcaatgta
accactgtgcgggaatatctgccagaaggagacttttcaataatgacagagatgctcaaa
aaatttttgagttttatgaatctcacttgtgctgttggaacaactggccagaaatctatc
tctagagtgattgaatatttggaacattgctag

DBGET integrated database retrieval system