KEGG   Homo sapiens (human): 23071Help
Entry
23071             CDS       T01001                                 

Gene name
ERP44, PDIA10, TXNDC4
Definition
(RefSeq) endoplasmic reticulum protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23071 (ERP44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    23071 (ERP44)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    23071 (ERP44)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   23071 (ERP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin HyaE OST3_OST6 Thioredoxin_2 Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 23071
NCBI-ProteinID: NP_055866
OMIM: 609170
HGNC: 18311
Ensembl: ENSG00000023318
Vega: OTTHUMG00000020363
Pharos: Q9BS26(Tbio)
UniProt: Q9BS26 A0A384MEE7
Structure
PDB: 

Position
9q31.1
AA seq 406 aa AA seqDB search
MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRF
SQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMK
REYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFER
VANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDK
CVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHAD
CDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREF
HHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctgccgtcttcctatccttacccgacctcagatgctcccttctgctcctggta
acttgggtttttactcctgtaacaactgaaataacaagtcttgatacagagaatatagat
gaaattttaaacaatgctgatgttgctttagtaaatttttatgctgactggtgtcgtttc
agtcagatgttgcatccaatttttgaggaagcttccgatgtcattaaggaagaatttcca
aatgaaaatcaagtagtgtttgccagagttgattgtgatcagcactctgacatagcccag
agatacaggataagcaaatacccaaccctcaaattgtttcgtaatgggatgatgatgaag
agagaatacaggggtcagcgatcagtgaaagcattggcagattacatcaggcaacaaaaa
agtgaccccattcaagaaattcgggacttagcagaaatcaccactcttgatcgcagcaaa
agaaatatcattggatattttgagcaaaaggactcggacaactatagagtttttgaacga
gtagcgaatattttgcatgatgactgtgcctttctttctgcatttggggatgtttcaaaa
ccggaaagatatagtggcgacaacataatctacaaaccaccagggcattctgctccggat
atggtgtacttgggagctatgacaaattttgatgtgacttacaattggattcaagataaa
tgtgttcctcttgtccgagaaataacatttgaaaatggagaggaattgacagaagaagga
ctgccttttctcatactctttcacatgaaagaagatacagaaagtttagaaatattccag
aatgaagtagctcggcaattaataagtgaaaaaggtacaataaactttttacatgccgat
tgtgacaaatttagacatcctcttctgcacatacagaaaactccagcagattgtcctgta
atcgctattgacagctttaggcatatgtatgtgtttggagacttcaaagatgtattaatt
cctggaaaactcaagcaattcgtatttgacttacattctggaaaactgcacagagaattc
catcatggacctgacccaactgatacagccccaggagagcaagcccaagatgtagcaagc
agtccacctgagagctccttccagaaactagcacccagtgaatataggtatactctattg
agggatcgagatgagctttaa

DBGET integrated database retrieval system