KEGG   Homo sapiens (human): 23074
Entry
23074             CDS       T01001                                 
Symbol
UHRF1BP1L, SHIP164
Name
(RefSeq) UHRF1 binding protein 1 like
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Chorein_N VPS13
Other DBs
NCBI-GeneID: 23074
NCBI-ProteinID: NP_055869
OMIM: 619811
HGNC: 29102
Ensembl: ENSG00000111647
Pharos: A0JNW5(Tdark)
UniProt: A0JNW5
Position
12:complement(100037072..100142874)
AA seq 1464 aa
MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGELKNLELDEEVLQNMLDLPTWLAINK
VFCNKASIRIPWTKLKTHPICLSLDKVIMEMSTCEEPRSPNGPSPIATASGQSEYGFAEK
VVEGISVSVNSIVIRIGAKAFNASFELSQLRIYSVNAHWEHGDLRFTRIQDPQRGEVLTF
KEINWQMIRIEADATQSSHLEIMCAPVRLITNQSKIRVTLKRRLKDCNVIATKLVLILDD
LLWVLTDSQLKAMVQYAKSLSEAIEKSTEQRKSMAPEPTQSSTVVASAQQVKTTQTSNAP
DVNDAIVKLFNDFDVKETSHHLVISHLDLHICDDIHAKEKESNRRITGGAMQLSFTQLTI
DYYPYHKAGDSCNHWMYFSDATKTKNGWANELLHEFECNVEMLKQAVKDHNVGSPPKSPT
HASPQHTQTEKDYPLKGTCRTPSVLSQQSKAKLMSSSVVVRLADFNIYQVSTAEQCRSSP
KSMICCNKKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILW
LNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAI
SIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRH
AHEQDTKMHEIYKGNITPQLNKNTLKTSAATDVWAVYFSQFWIDYEGMKSGKGRPISFVD
SFPLSIWICQPTRYAESQKEPQTCNQVSLNTSQSESSDLAGRLKRKKLLKEYYSTESEPL
TNGGQKPSSSDTFFRFSPSSSEADIHLLVHVHKHVSMQINHYQYLLLLFLHESLILLSEN
LRKDVEAVTGSPASQTSICIGILLRSAELALLLHPVDQANTLKSPVSESVSPVVPDYLPT
ENGDFLSSKRKQISRDINRIRSVTVNHMSDNRSMSVDLSHIPLKDPLLFKSASDTNLQKG
ISFMDYLSDKHLGKISEDESSGLVYKSGSGEIGSETSDKKDSFYTDSSSILNYREDSNIL
SFDSDGNQNILSSTLTSKGNETIESIFKAEDLLPEAASLSENLDISKEETPPVRTLKSQS
SLSGKPKERCPPNLAPLCVSYKNMKRSSSQMSLDTISLDSMILEEQLLESDGSDSHMFLE
KGNKKNSTTNYRGTAESVNAGANLQNYGETSPDAISTNSEGAQENHDDLMSVVVFKITGV
NGEIDIRGEDTEICLQVNQVTPDQLGNISLRHYLCNRPVGSDQKAVIHSKSSPEISLRFE
SGPGAVIHSLLAEKNGFLQCHIENFSTEFLTSSLMNIQHFLEDETVATVMPMKIQVSNTK
INLKDDSPRSSTVSLEPAPVTVHIDHLVVERSDDGSFHIRDSHMLNTGNDLKENVKSDSV
LLTSGKYDLKKQRSVTQATQTSPGVPWPSQSANFPEFSFDFTREQLMEENESLKQELAKA
KMALAEAHLEKDALLHHIKKMTVE
NT seq 4395 nt   +upstreamnt  +downstreamnt
atggccgggatcatcaagaaacaaatcttgaagcacctctccagatttaccaaaaattta
tctcctgacaagataaatctaagtacccttaaaggagaaggtgaactgaagaatttggag
ttggatgaagaagtactccagaatatgttggatttgccaacatggcttgctatcaacaaa
gttttttgtaataaagcgtccattaggatcccatggacaaaactgaaaacacatcccatc
tgtttgtccctggataaagtaataatggaaatgagtacatgtgaagaaccaagaagccct
aatggcccatcaccaattgcaactgcttcaggacaaagtgaatacggctttgctgaaaaa
gtagttgagggaatttctgtttctgtaaattctatagtcatcagaattggagcaaaagcc
ttcaatgcatcatttgaactttctcagcttcggatctatagtgtaaatgcacactgggaa
catggagatttgagatttactcgtattcaggatccacagagaggagaggttttgactttt
aaagaaataaattggcagatgataagaatagaggcagatgccacccaaagttcacatctt
gaaattatgtgtgctcctgttcgattaataaccaaccaatcaaaaatcagagtcacactt
aaaagaaggttaaaggactgcaatgtcatagcaacaaagttagttctaatattggatgac
ttattatgggttttgactgattcccagttgaaagctatggtacaatatgcaaagtctctt
agtgaagcaatagaaaaatcaacagaacaaaggaagagtatggctcctgaacctacacag
agctctacagtagtcgcatctgcccagcaagtgaagacaacgcaaacttcaaatgctcct
gatgtaaatgatgcaattgtgaaactattcaatgattttgatgttaaggaaacctcccat
catttagtgatttctcatctagatctacacatatgtgatgacattcatgctaaagaaaaa
gagtcaaacagacgtattactggaggggcaatgcaactctcttttacacagctaactata
gattattatccttatcataaagcaggagatagttgtaatcattggatgtattttagtgat
gcaaccaaaacaaaaaatggatgggccaatgagttattgcatgaatttgagtgcaacgtt
gaaatgcttaaacaggctgtgaaggatcataatgtaggttcacctcctaaatccccaaca
catgcctctccccagcacacacaaacagagaaggactaccctctgaaagggacatgcaga
acaccttcagtattatctcaacaatcaaaagctaagctaatgtctagttctgttgtggtt
agacttgcagatttcaatatataccaggtctctacagcggaacaatgtcgttcttccccc
aaaagcatgatttgctgcaataaaaaatccctatatcttccacaagaaatgtcagctgtc
tatatagaattcacagaatattactatccagatggaaaggattttccaattccatctccc
aacctctatagccagctgaatgcactacagtttactgtggatgaaagaagcattctatgg
ttaaatcaatttctgttggatttaaaacagagtcttaatcagttcatggctgtgtacaag
ttgaatgacaattcaaaatctgacgagcatgttgatgttcgagttgatggcttaatgcta
aagtttgtcattccttctgaagtgaaatctgaatgtcatcaagatcagccacgtgcaatt
tctattcagagttctgaaatgattgccacaaatacaaggcactgtccaaactgtcgacat
tctgacctagaagctttgtttcaagactttaaagattgtgatttttttagtaaaacatat
accagcttccccaaatcttgtgacaattttaatcttctacatccaattttccagagacat
gctcatgaacaagataccaaaatgcatgaaatttataaaggaaatattactccccaattg
aataaaaacactcttaaaacttctgctgccacggatgtttgggctgtgtacttttctcaa
ttttggatagattatgaagggatgaaaagtggaaaaggacggccaataagttttgtagac
tcattccctctttccatttggatttgtcaaccaacaagatatgcagagtcacaaaaagag
ccgcagacttgtaatcaggtatctctaaatacatcacaaagtgaatctagtgatctggct
ggccgattgaagcggaagaagctcttgaaggagtattatagtacagagtctgagcctttg
acaaatggtggtcagaagccttcttcatcagatacatttttcagattttccccttcctcg
tcagaggcagatattcatctcctagttcatgttcataaacatgtcagtatgcagattaat
cactaccagtatctgcttctacttttcctgcatgagtcacttatcctgctttcagagaac
ttaaggaaagatgtagaagctgtaactggcagtcctgctagtcagacatccatttgtatt
ggaattttacttagaagtgcagaactggctcttttgctccatccagtggatcaagcaaat
actcttaagtctcctgtttctgaaagtgtgagcccagtggtacctgattatttgcctaca
gaaaatggggattttttgtcttcaaaaagaaaacaaattagtagggatataaatagaatt
agaagtgtaactgttaatcatatgtcagacaacagatctatgagtgttgaccttagccat
atccctttaaaggatcctttgctttttaaatcagctagtgatacaaatctgcaaaaaggc
atttcttttatggactatttatcagataaacatttagggaaaataagtgaagatgaaagt
agtggacttgtttacaaaagtggctcaggagaaattggatcagaaacaagtgacaaaaag
gattcattttatacagattcaagtagtatcttaaactacagagaagattcgaatatactt
tcatttgatagtgatggtaatcaaaacatactttcaagtactttaactagtaaaggaaat
gaaaccatagagtccatctttaaagctgaagatttgcttccagaagcagcttcactctct
gaaaacctggatatcagtaaagaagagacccccccagttagaacacttaaatcacagtca
tctttaagtggaaagcctaaggaacgttgcccacccaacctggctcctctctgtgtttct
tataagaatatgaaaagaagctcttcacaaatgtcattggataccatttcacttgacagc
atgatattggaagaacagttattagaaagtgatggaagtgatagccatatgtttttggaa
aaaggaaataaaaagaactcaactacaaattacaggggcacagcagaaagtgtgaatgct
ggtgcaaacctacagaattatggtgaaacttctccagatgccatcagtacaaattcagag
ggtgctcaggaaaatcatgatgacctgatgtccgttgtggtatttaaaattactggtgtt
aatggggaaattgacatccgaggggaagatacagaaatctgtcttcaagtgaaccaggtg
acaccagaccaattaggcaatatcagccttcggcattacctttgtaatcgtccagttggt
tccgatcagaaagctgtaattcattccaaatcctctcctgagatttctctgagatttgaa
agtgggcctggtgctgtaatacactctttacttgcagaaaaaaatggatttctgcagtgc
cacatagaaaacttcagcactgagtttcttacatcttctcttatgaatattcaacatttt
ttggaagatgaaactgttgcaacagtaatgccaatgaagatacaagtttctaacacgaaa
ataaatttaaaagatgatagtccccggagtagtacagtatcccttgaaccagctcctgta
actgtacatattgatcatcttgtggtagagagaagtgacgatggctcttttcatatcaga
gattctcacatgcttaacactggaaatgatttgaaagaaaatgtcaaaagcgattcagtg
ctgctgaccagtggaaagtatgatctgaagaaacaacgcagtgtcacgcaagccactcag
acaagcccaggggttccttggccttctcagtcagctaactttcctgagttctcctttgac
ttcactagggaacagctcatggaagagaatgaatctcttaaacaggaactggctaaagct
aaaatggctcttgcagaggctcacttggaaaaagatgctcttcttcatcatataaagaag
atgacagttgaatag

DBGET integrated database retrieval system