KEGG   Homo sapiens (human): 23076Help
Entry
23076             CDS       T01001                                 

Gene name
RRP1B, KIAA0179, NNP1L, Nnp1, PPP1R136, RRP1
Definition
(RefSeq) ribosomal RNA processing 1B
  KO
K14849  ribosomal RNA-processing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23076 (RRP1B)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    23076 (RRP1B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     23076 (RRP1B)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    23076 (RRP1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop52
Motif
Other DBs
NCBI-GeneID: 23076
NCBI-ProteinID: NP_055871
OMIM: 610654
HGNC: 23818
Ensembl: ENSG00000160208
Vega: OTTHUMG00000086872
Pharos: Q14684(Tbio)
UniProt: Q14684
Position
21q22.3
AA seq 758 aa AA seqDB search
MAPAMQPAEIQFAQRLASSEKGIRDRAVKKLRQYISVKTQRETGGFSQEELLKIWKGLFY
CMWVQDEPLLQEELANTIAQLVHAVNNSAAQHLFIQTFWQTMNREWKGIDRLRLDKYYML
IRLVLRQSFEVLKRNGWEESRIKVFLDVLMKEVLCPESQSPNGVRFHFIDIYLDELSKVG
GKELLADQNLKFIDPFCKIAAKTKDHTLVQTIARGVFEAIVDQSPFVPEETMEEQKTKVG
DGDLSAEEIPENEVSLRRAVSKKKTALGKNHSRKDGLSDERGRDDCGTFEDTGPLLQFDY
KAVADRLLEMTSRKNTPHFNRKRLSKLIKKFQDLSEGSSISQLSFAEDISADEDDQILSQ
GKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAA
PSLEQNRGREPEASGLKALKARVAEPGAEATSSTGEESGSEHPPAVPMHNKRKRPRKKSP
RAHREMLESAVLPPEDMSQSGPSGSHPQGPRGSPTGGAQLLKRKRKLGVVPVNGSGLSTP
AWPPLQQEGPPTGPAEGANSHTTLPQRRRLQKKKAGPGSLELCGLPSQKTASLKKRKKMR
VMSNLVEHNGVLESEAGQPQALGSSGTCSSLKKQKLRAESDFVKFDTPFLPKPLFFRRAK
SSTATHPPGPAVQLNKTPSSSKKVTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQK
PLHGVLKTPTSSPASSPLVAKKPLTTTPRRRPRAMDFF
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgccatgcagccggccgagatccaatttgcccagcggctggcgtccagcgag
aagggcatccgggaccgagcggtgaagaagctgcgccagtacatcagcgtgaagacgcag
agggagacaggaggtttcagtcaggaagaacttctgaaaatctggaaggggctcttctac
tgcatgtgggtgcaggatgaaccccttctacaggaagagctcgccaacaccattgcacag
ctagtccatgctgttaacaactcagcggctcaacacctgttcattcagaccttttggcaa
accatgaatcgagaatggaaaggaatagacaggctacgcctggacaaatactatatgctg
attcgtctggtcctgaggcagtcctttgaagtcttgaagcgaaatggctgggaagaaagc
cgaatcaaggttttcttggatgtcctgatgaaggaggtcctgtgtcctgagagtcagtct
cctaatggagtgagattccacttcattgatatttacctggatgaactctccaaagtcggg
gggaaggagcttttagcagatcagaatctcaagtttatcgatccattctgcaaaattgct
gcgaagacgaaggaccacaccctggtacagaccatagctcggggtgtcttcgaagctatc
gtagatcagtctccttttgtgcctgaagagacgatggaggaacagaagacaaaagtgggt
gatggtgacctctctgctgaggagatacctgaaaatgaggtatccttgagaagagctgtc
agtaaaaagaagacagcactgggcaaaaaccattccagaaaagatggactcagtgatgaa
agaggaagagatgactgtggaacctttgaggacacagggccccttctccagtttgactat
aaggctgttgctgatcgactcctggaaatgaccagcaggaagaacacgccccacttcaac
aggaagcgcctctccaaactcatcaagaaattccaagacctttctgaaggaagcagtata
tctcaactcagttttgcggaggacatttctgctgatgaagatgaccaaatcctcagtcaa
ggaaagcataagaagaaaggaaataaacttttagagaaaactaacttggaaaaggagaaa
ggaagcagagtcttttgtgtagaggaagaggacagtgaaagcagtcttcaaaagagaaga
aggaagaagaagaagaagcaccacctgcagcctgaaaatccaggcccagggggtgcagcc
ccatccctggaacagaaccggggcagggagcccgaggcctctgggctgaaagccctgaag
gcacgtgtggccgagccaggtgcagaggccacgtccagcactggggaggagagtggctcc
gagcatcctccagccgtccccatgcacaataaaaggaaacggccacggaagaagagcccg
agggcccacagggaaatgttggaatcagcagtgttgcccccagaggacatgtctcagagt
ggcccgagtggcagtcatcctcagggacctagagggtccccgacaggtggagcccaactc
ctaaaaaggaagcggaaacttggagttgtgcccgtcaatggcagtggcctgtccacgccg
gcctggcctccattgcagcaggaaggccctcccacaggccccgcagagggggcgaacagc
cacaccacgctgccccagcgcaggaggctgcagaaaaagaaggcagggcccggcagcctg
gagctctgtggcctgcccagccagaaaacagcaagtttgaaaaagaggaagaaaatgaga
gtgatgtcaaacttggtggagcacaacggggtgctggagtccgaagctgggcaaccccag
gctctgggaagcagtgggacttgcagttccctgaagaagcagaagctgagggcagagagc
gactttgtgaagtttgacacccccttcttaccaaagcccctgttcttcagaagagccaag
agcagcactgccacccaccctccaggccctgccgtccagctaaacaagacaccatccagc
tccaagaaagtcacctttgggctgaacagaaacatgactgccgaattcaagaagacagac
aagagtatcttggtcagtcccacgggcccttctcgagtggccttcgaccctgaacagaag
cccctccacggggtgctgaagacccccaccagctcacctgccagctcacccctggtggcc
aagaagcccctgaccaccacaccaaggagaaggcccagggctatggatttcttctga

DBGET integrated database retrieval system