KEGG   Homo sapiens (human): 23081
Entry
23081             CDS       T01001                                 

Gene name
KDM4C, GASC1, JHDM3C, JMJD2C, TDRD14C
Definition
(RefSeq) lysine demethylase 4C
  KO
K06709  [histone H3]-trimethyl-L-lysine9/36 demethylase [EC:1.14.11.66 1.14.11.69]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23081 (KDM4C)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.66  [histone H3]-trimethyl-L-lysine9 demethylase
     23081 (KDM4C)
    1.14.11.69  [histone H3]-trimethyl-L-lysine36 demethylase
     23081 (KDM4C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    23081 (KDM4C)
SSDB
Motif
Pfam: JmjC zf-HC5HC2H_2 Tudor_2 zf-HC5HC2H PHD_2 JmjN LBR_tudor PHD 53-BP1_Tudor Tudor_3 TUDOR_5 DUF4609
Other DBs
NCBI-GeneID: 23081
NCBI-ProteinID: NP_055876
OMIM: 605469
HGNC: 17071
Ensembl: ENSG00000107077
Vega: OTTHUMG00000019536 OTTHUMG00000187508
Pharos: Q9H3R0(Tchem)
UniProt: Q9H3R0
Structure
PDB: 

Position
9p24.1
AA seq 1056 aa
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
NIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGER
KRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ
NT seq 3171 nt   +upstreamnt  +downstreamnt
atggaggtggccgaggtggaaagtcctctgaaccccagctgtaagataatgaccttcaga
ccctccatggaggagttccgggagttcaacaaataccttgcatacatggagtctaaagga
gcccatcgtgcgggtcttgcaaaggtgattcctcctaaggagtggaagccaagacagtgc
tatgatgacattgataatttgctcattccagcaccaattcagcagatggtcacagggcag
tcaggactgttcactcagtacaacatccagaaaaaagcgatgactgtgaaggagttcagg
cagctggccaacagtggcaaatattgtactccaagatacttggattacgaagatttggag
cgcaagtactggaagaacttaacttttgtggcacctatctatggtgcagatattaatggg
agcatatatgatgagggtgtggatgaatggaacatagctcgcctcaatacagtcttggat
gtggttgaagaagagtgtggcatttctattgagggtgtaaataccccatatctctatttt
ggcatgtggaagaccacgtttgcatggcacaccgaagacatggacctctatagcattaat
tatctccactttggagagcccaagtcttggtatgctatacctccggagcatggaaaacga
cttgaaagactagctcaaggttttttcccaagcagctcccaagggtgtgatgcatttctt
cgccacaagatgacattgatttctccatcagtattgaagaaatatggtattccctttgac
aagataacccaggaggctggagaattcatgatcactttcccatatggctaccatgctggt
tttaatcatggtttcaactgtgcagaatctacaaattttgctactgtcagatggattgac
tatggaaaagttgccaaattgtgcacttgcaggaaagacatggtgaagatttcaatggat
atctttgtgaggaaatttcagccagacagatatcagctttggaaacaaggaaaggatata
tacaccattgatcacacgaagcctactccagcatccacccctgaagtaaaagcatggctg
cagaggaggaggaaagtaagaaaagcatcccgaagcttccagtgtgctaggtctacctct
aaaaggcctaaggctgatgaggaagaggaagtgtcagatgaagtcgatggggcagaggtc
cctaaccccgactcagtcacagatgacctcaaggtcagtgaaaagtcagaagcagcagtg
aagctgaggaacacagaagcatcttcagaagaagagtcatctgctagcaggatgcaggtg
gagcagaatttatcagatcatatcaaactctcaggaaacagctgcttaagtacatctgta
acagaagacataaaaactgaggatgacaaagcttatgcatatagaagtgtaccttctata
tccagtgaggctgatgattccattccattgtctagtggctatgagaagcccgagaaatca
gacccatccgagctttcatggccaaagtcacctgagtcatgctcatcagtggcagagagt
aatggtgtgttaacagagggagaagagagtgatgtggagagccatgggaatggccttgaa
cctggggaaatcccagcggtccccagtggagagagaaatagcttcaaagtccccagtata
gcagagggagagaacaaaacctctaagagttggcgccatccacttagcaggcctccagca
agatctccgatgactcttgtgaagcagcaggcgccaagtgatgaagaattgcctgaggtt
ctgtccattgaggaggaagtggaagaaacagagtcttgggcgaaacctctcatccacctt
tggcagacgaagtcccctaacttcgcagctgagcaagagtataatgcaacagtggccagg
atgaagccacactgtgccatctgcactctgctcatgccgtaccacaagccagatagcagc
aatgaagaaaatgatgctagatgggagacaaaattagatgaagtcgttacatcggaggga
aagactaagcccctcataccagagatgtgttttatttatagtgaagaaaatatagaatat
tctccacccaatgccttccttgaagaggatggaacaagtctccttatttcctgtgcaaag
tgctgcgtacgggttcatgcaagttgttatggtattccttctcatgagatctgtgatgga
tggctgtgtgcccggtgcaaaagaaatgcgtggacagcagaatgctgtctctgcaatttg
agaggaggtgctcttaagcaaacgaagaacaataagtgggcccatgtcatgtgcgccgtt
gcggtcccagaagttcgattcactaatgtcccagaaaggacacaaatagatgtaggcaga
atacctttacagaggttaaaattgaaatgcatcttctgcagacaccgggttaagagggtc
tctggagcctgcatccagtgttcctacggtcgctgcccggcctccttccatgtcacttgt
gcccatgctgctggggtactgatggagcctgatgactggccttatgtggtgaacattaca
tgctttcgacataaggtcaaccccaacgtgaagtccaaggcttgcgagaaggtcatttcc
gtgggtcaaacggtcatcacgaagcatcggaacacccggtattacagttgcagagtgatg
gctgtgacatcgcagaccttctatgaggtcatgtttgatgatggctcctttagcagagac
acatttcctgaggatatcgtgagccgagactgtctgaagctgggcccacctgctgaggga
gaagtcgtccaagtcaagtggcccgatggcaaactctatggagcaaaatattttggatca
aatattgcccacatgtaccaggttgagtttgaagatggatcccagatagcaatgaagaga
gaggacatctacactttagatgaagagttacccaagagagtgaaagctcgattttccaca
gcctctgacatgcgatttgaagacacgttttatggagcagacattatccaaggggagaga
aagagacaaagagtgctgagctccaggtttaagaatgaatatgtggccgaccctgtatac
cgcacttttttgaagagctctttccagaagaagtgccagaagagacagtag

DBGET integrated database retrieval system