KEGG   Homo sapiens (human): 2309Help
Entry
2309              CDS       T01001                                 

Gene name
FOXO3, AF6q21, FKHRL1, FKHRL1P2, FOXO2, FOXO3A
Definition
(RefSeq) forkhead box O3
  KO
K09408  forkhead box protein O3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04062  Chemokine signaling pathway
hsa04068  FoxO signaling pathway
hsa04137  Mitophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04218  Cellular senescence
hsa04722  Neurotrophin signaling pathway
hsa04917  Prolactin signaling pathway
hsa05213  Endometrial cancer
hsa05223  Non-small cell lung cancer
Module
hsa_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    2309 (FOXO3)
   04151 PI3K-Akt signaling pathway
    2309 (FOXO3)
   04152 AMPK signaling pathway
    2309 (FOXO3)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    2309 (FOXO3)
  Cell growth and death
   04218 Cellular senescence
    2309 (FOXO3)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2309 (FOXO3)
  Endocrine system
   04917 Prolactin signaling pathway
    2309 (FOXO3)
  Nervous system
   04722 Neurotrophin signaling pathway
    2309 (FOXO3)
  Aging
   04211 Longevity regulating pathway - mammal
    2309 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    2309 (FOXO3)
 Human Diseases
  Cancers
   05213 Endometrial cancer
    2309 (FOXO3)
   05223 Non-small cell lung cancer
    2309 (FOXO3)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    2309 (FOXO3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    2309 (FOXO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Motif
Other DBs
NCBI-GeneID: 2309
NCBI-ProteinID: NP_001446
OMIM: 602681
HGNC: 3821
Ensembl: ENSG00000118689
Vega: OTTHUMG00000015327
Pharos: O43524(Tbio)
UniProt: O43524
Structure
PDB: 

Position
6q21
AA seq 673 aa AA seqDB search
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLS
GGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTL
SQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDG
GKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS
DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSK
PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLS
HSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQT
QGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP
VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFT
GAKQASSQSWVPG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcaccggcttccccggccccgctctctccgctcgaagtggagctggacccg
gagttcgagccccagagccgtccgcgatcctgtacgtggcccctgcaaaggccggagctc
caagcgagccctgccaagccctcgggggagacggccgccgactccatgatccccgaggag
gaggacgatgaagacgacgaggacggcgggggacgggccggctcggccatggcgatcggc
ggcggcggcgggagcggcacgctgggctccgggctgctccttgaggactcggcccgggtg
ctggcacccggagggcaagaccccgggtctgggccagccaccgcggcgggcgggctgagc
gggggtacacaggcgctgctgcagcctcagcaaccgctgccaccgccgcagccgggggcg
gctgggggctccgggcagccgaggaaatgttcgtcgcggcggaacgcctggggaaacctg
tcctacgcggacctgatcacccgcgccatcgagagctccccggacaaacggctcactctg
tcccagatctacgagtggatggtgcgttgcgtgccctacttcaaggataagggcgacagc
aacagctctgccggctggaagaactccatccggcacaacctgtcactgcatagtcgattc
atgcgggtccagaatgagggaactggcaagagctcttggtggatcatcaaccctgatggg
gggaagagcggaaaagccccccggcggcgggctgtctccatggacaatagcaacaagtat
accaagagccgtggccgcgcagccaagaagaaggcagccctgcagacagcccccgaatca
gctgacgacagtccctcccagctctccaagtggcctggcagccccacgtcacgcagcagt
gatgagctggatgcgtggacggacttccgttcacgcaccaattctaacgccagcacagtc
agtggccgcctgtcgcccatcatggcaagcacagagttggatgaagtccaggacgatgat
gcgcctctctcgcccatgctctacagcagctcagccagcctgtcaccttcagtaagcaag
ccgtgcacggtggaactgccacggctgactgatatggcaggcaccatgaatctgaatgat
gggctgactgaaaacctcatggacgacctgctggataacatcacgctcccgccatcccag
ccatcgcccactgggggactcatgcagcggagctctagcttcccgtataccaccaagggc
tcgggcctgggctccccaaccagctcctttaacagcacggtgttcggaccttcatctctg
aactccctacgccagtctcccatgcagaccatccaagagaacaagccagctaccttctct
tccatgtcacactatggtaaccagacactccaggacctgctcacttcggactcacttagc
cacagcgatgtcatgatgacacagtcggaccccttgatgtctcaggccagcaccgctgtg
tctgcccagaattcccgccggaacgtgatgcttcgcaatgatccgatgatgtcctttgct
gcccagcctaaccagggaagtttggtcaatcagaacttgctccaccaccagcaccaaacc
cagggcgctcttggtggcagccgtgccttgtcgaattctgtcagcaacatgggcttgagt
gagtccagcagccttgggtcagccaaacaccagcagcagtctcctgtcagccagtctatg
caaaccctctcggactctctctcaggctcctccttgtactcaactagtgcaaacctgccc
gtcatgggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttg
gaatgtgacatggagtccattatccgtagtgaactcatggatgctgatgggttggatttt
aactttgattccctcatctccacacagaatgttgttggtttgaacgtggggaacttcact
ggtgctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system