KEGG   Homo sapiens (human): 23092
Entry
23092             CDS       T01001                                 
Symbol
ARHGAP26, GRAF, GRAF1, OPHN1L, OPHN1L1
Name
(RefSeq) Rho GTPase activating protein 26
  KO
K20071  Rho GTPase-activating protein 26
Organism
hsa  Homo sapiens (human)
Disease
H02541  Jvenile myelomonocytic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23092 (ARHGAP26)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    23092 (ARHGAP26)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    23092 (ARHGAP26)
SSDB
Motif
Pfam: BAR_3 RhoGAP PH SH3_9 SH3_1 SH3_2 IMD
Other DBs
NCBI-GeneID: 23092
NCBI-ProteinID: NP_055886
OMIM: 605370
HGNC: 17073
Ensembl: ENSG00000145819
Pharos: Q9UNA1(Tbio)
UniProt: Q9UNA1
Structure
Position
5:142770377..143229011
AA seq 814 aa
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKNLSSAKRKF
ADSLNEFKFQCIGDAETDDEMCIARSLQEFATVLRNLEDERIRMIENASEVLITPLEKFR
KEQIGAAKEAKKKYDKETEKYCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLE
YVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFGDFKTQLTISIQNTRNRFE
GTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITM
VPFDQKSGGKGGEDESVILKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQALSEEDRRLW
MEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQGLYRIVGVNSRV
QKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLE
NQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQ
EETVAAIMDIKFQNIVIEILIENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERP
LTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRP
NSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVRSVAGFVWFSVAAVVLSLARS
SLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAG
TVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL
NT seq 2445 nt   +upstreamnt  +downstreamnt
atggggctcccagcgctcgagttcagcgactgctgcctcgatagtccgcacttccgagag
acgctcaagtcgcacgaagcagagctggacaagaccaacaaattcatcaaggagctcatc
aaggacgggaagtcactcataagcgcgctcaagaatttgtcttcagcgaagcggaagttt
gcagattccttaaatgaatttaaatttcagtgcataggagatgcagaaacagatgatgag
atgtgtatagcaagatctttgcaggagtttgccactgtcctcaggaatcttgaagatgaa
cggatacggatgattgagaatgccagcgaggtgctcatcactcccttggagaagtttcga
aaggaacagatcggggctgccaaggaagccaaaaagaagtatgacaaagagacagaaaag
tattgtggcatcttagaaaaacacttgaatttgtcttccaaaaagaaagaatctcagctt
caggaggcagacagccaagtggacctggtccggcagcatttctatgaagtatccctggaa
tatgtcttcaaggtgcaggaagtccaagagagaaagatgtttgagtttgtggagcctctg
ctggccttcctgcaaggactcttcactttctatcaccatggttacgaactggccaaggat
ttcggggacttcaagacacagttaaccattagcatacagaacacaagaaatcgctttgaa
ggcactagatcagaagtggaatcactgatgaaaaagatgaaggagaatccccttgagcac
aagaccatcagtccctacaccatggagggatacctctacgtgcaggagaaacgtcacttt
ggaacttcttgggtgaagcactactgtacatatcaacgggattccaaacaaatcaccatg
gtaccatttgaccaaaagtcaggaggaaaagggggagaagatgaatcagttatcctcaaa
tcctgcacacggcggaaaacagactccattgagaagaggttttgctttgatgtggaagca
gtagacaggccaggggttatcaccatgcaagctttgtcggaagaggaccggaggctctgg
atggaagccatggatggccgggaacctgtctacaactcgaacaaagacagccagagtgaa
gggactgcgcagttggacagcattggcttcagcataatcaggaaatgcatccatgctgtg
gaaaccagagggatcaacgagcaagggctgtatcgaattgtgggtgtcaactccagagtg
cagaagttgctgagtgtcctgatggaccccaagactgcttctgagacagaaacagatatc
tgtgctgaatgggagataaagaccatcactagtgctctgaagacctacctaagaatgctt
ccaggaccactcatgatgtaccagtttcaaagaagtttcatcaaagcagcaaaactggag
aaccaggagtctcgggtctctgaaatccacagccttgttcatcggctcccagagaaaaat
cggcagatgttacagctgctcatgaaccacttggcaaatgttgctaacaaccacaagcag
aatttgatgacggtggcaaaccttggtgtggtgtttggacccactctgctgaggcctcag
gaagaaacagtagcagccatcatggacatcaaatttcagaacattgtcattgagatccta
atagaaaaccacgaaaagatatttaacaccgtgcccgatatgcctctcaccaatgcccag
ctgcacctgtctcggaagaagagcagtgactccaagcccccgtcctgcagcgagaggccc
ctgacgctcttccacaccgttcagtcaacagagaaacaggaacaaaggaacagcatcatc
aactccagtttggaatctgtctcatcaaatccaaacagcatccttaattccagcagcagc
ttacagcccaacatgaactccagtgacccagacctggctgtggtcaaacccacccggccc
aactcactccccccgaatccaagcccaacttcacccctctcgccatcttggcccatgttc
tcggcgccatccagccctatgcccacctcatccacgtccagcgactcatcccccgtcagg
tctgttgcagggtttgtttggttttctgttgctgccgttgttctctcattggctcggtcc
tctcttcatgcagtgttcagcctcctcgtcaactttgttccctgccatccaaacctgcac
ttgctttttgacaggccagaagaagcggtacatgaagactccagcacaccgttccggaag
gcaaaagccttgtatgcctgcaaagctgaacatgactcagaactttcgttcacagcaggc
acggtcttcgataacgttcacccatctcaggagcctggctggttggaggggactctgaac
ggaaagactggcctcatccctgagaattacgtggagttcctctaa

DBGET integrated database retrieval system