KEGG   Homo sapiens (human): 23095Help
Entry
23095             CDS       T01001                                 

Gene name
KIF1B, CMT2, CMT2A, CMT2A1, HMSNII, KLP, NBLST1
Definition
(RefSeq) kinesin family member 1B
  KO
K10392  kinesin family member 1
Organism
hsa  Homo sapiens (human)
Disease
H00264  Charcot-Marie-Tooth disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    23095 (KIF1B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     23095 (KIF1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Kinesin_assoc DUF3694 Microtub_bd KIF1B PH FHA Yop-YscD_cpl
Motif
Other DBs
NCBI-GeneID: 23095
NCBI-ProteinID: NP_055889
OMIM: 605995
HGNC: 16636
Ensembl: ENSG00000054523
Vega: OTTHUMG00000001817
Pharos: O60333(Tbio)
UniProt: O60333
Structure
PDB: 

Position
1p36.22
AA seq 1770 aa AA seqDB search
MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHT
SPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIP
QLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPY
RDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNA
KLVRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSSCSLSSQVGLTSVTSIQERIMS
TPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVF
SPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSE
RSNSGEVIVTLEPCERSETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREK
TPSAETPSEPVDWTFAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLLEQQRLD
YESKLQALQKQVETRSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLL
WGNAVYLKEANAISVELKKKVQFQFVLLTDTLYSPLPPELLPTEMEKTHEDRPFPRTVVA
VEVQDLKNGATHYWSLEKLKQRLDLMREMYDRAGEMASSAQDESETTVTGSDPFYDRFHW
FKLVGSSPIFHGCVNERLADRTPSPTFSTADSDITELADEQQDEMEDFDDEAFVDDAGSD
AGTEEGSDLFSDGHDPFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAIVSEKGEVRGFL
RVAVQAIAADEEAPDYGSGIRQSGTAKISFDNEYFNQSDFSSVAMTRSGLSLEELRIVEG
QGQSSEVITPPEEISRINDLDLKSSTLLDGKMVMEGFSEEIGNHLKLGSAFTFRVTVLQA
SGILPEYADIFCQFNFLHRHDEAFSTEPLKNNGRGSPLAFYHVQNIAVEITESFVDYIKT
KPIVFEVFGHYQQHPLHLQGQELNSPPQPCRRFFPPPMPLSKPVPATKLNTMSKTSLGQS
MSKYDLLVWFEISELEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSEL
HWKDVRELVVGRIRNKPEVDEAAVDAILSLNIISAKYLKSSHNSSRTFYRFEAVWDSSLH
NSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRSLFG
SGYSKSPDSNRVTGIYELSLCKMSDTGSPGMQRRRRKILDTSVAYVRGEENLAGWRPRGD
SLILEHQWELEKLELLHEVEKTRHFLLLRERLGDSIPKSLSDSLSPSLSSGTLSTSTSIS
SQISTTTFESAITPSESSGYDSGDIESLVDREKELATKCLQLLTHTFNREFSQVHGSVSD
CKLSDISPIGRDPSESSFSSATLTPSSTCPSLVDSRSNSLDQKTPEANSRASSPCPEFEQ
FQIVPAVETPYLARAGKNEFLNLVPDIEEIRPSSVVSKKGYLHFKEPLYSNWAKHFVVVR
RPYVFIYNSDKDPVERGIINLSTAQVEYSEDQQAMVKTPNTFAVCTKHRGVLLQALNDKD
MNDWLYAFNPLLAGTIRSKLSRRCPSQSKY
NT seq 5313 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggagcctcagtgaaggtggctgtccgggtaaggcccttcaattctcgagagacc
agcaaggaatccaaatgcatcattcagatgcaaggcaactcgaccagtattattaaccca
aagaatccaaaggaagctccaaagtccttcagcttcgactattcctactggtctcatacc
tcacccgaagatccctgttttgcatctcaaaaccgtgtgtacaatgacattggcaaggaa
atgctcttacacgcctttgagggatataatgtctgtatttttgcctatgggcagactggt
gctggaaaatcttatacaatgatgggtaaacaagaagaaagccaggctggcatcattcca
cagttatgtgaagaactttttgagaaaatcaatgacaactgtaatgaagaaatgtcttac
tctgtagaggtgagctacatggaaatttactgtgaaagagtacgagatttgctgaatcca
aaaaacaagggtaatttgcgtgtgcgtgaacacccacttcttggaccctatgtggaggat
ctgtccaagttggcagttacttcctacacagacattgctgacctcatggatgctgggaac
aaagccaggacagtggcagctacaaacatgaatgaaacaagtagccgttcccacgctgtg
tttacgattgttttcacccagaagaaacacgataatgagaccaacctttccactgagaag
gtcagtaaaatcagcttggtggatctagcaggaagtgaacgagctgattcaactggtgcc
aaagggactcgattaaaggaaggagcaaatattaataagtctcttacaactttgggcaaa
gtcatttcagccttggccgaggtgagtaaaaagaagaagaaaacagattttattccctac
agggattctgtacttacttggctccttcgagaaaatttaggtggcaattctcggactgca
atggttgctgctctgagccccgcggatatcaactacgatgagactttgagcactctgaga
tatgcagatcgtgcaaaacaaattaaatgcaatgctgttatcaatgaggaccccaatgcc
aaactggttcgtgaattaaaggaggaggtgacacggctgaaggaccttcttcgtgctcag
ggcctgggagatattattgatacatccatggggtccctcacttcatccccatcttcctgc
tcactcagtagtcaggtgggcttgacgtctgtgaccagtattcaagagaggatcatgtct
acacctggaggagaggaagctattgaacgtttaaaggaatcagagaagatcattgctgag
ttgaatgaaacttgggaagagaagcttcgtaaaacagaggccatcagaatggagagagag
gctttgttggctgagatgggagttgccattcgggaagatggaggaaccctaggggttttc
tcacctaaaaagaccccacatcttgttaacctcaatgaagacccactaatgtctgagtgc
ctactttattacatcaaagatggaattacaagggttggccaagcagatgctgagcggcgc
caggacatagtgctgagcggggctcacattaaagaagagcattgtatcttccggagtgag
agaagcaacagcggggaagttatcgtgaccttagagccctgtgagcgctcagaaacctac
gtaaatggcaagagggtgtcccagcctgttcagctgcgctcaggaaaccgtatcatcatg
ggtaaaaaccatgttttccgctttaaccacccggaacaagcacgagctgagcgagagaag
actccttctgctgagaccccctctgagcctgtggactggacatttgcccagagggagctt
ctggaaaaacaaggaattgatatgaaacaagagatggagaaaaggctacaggaaatggag
atcttatacaaaaaggagaaggaagaagcagatcttcttttggagcagcagagactggac
tatgagagtaaattgcaggccttgcagaagcaggttgaaacccgatctctggctgcagaa
acaactgaagaggaggaagaagaggaagaagttccttggacacagcatgaatttgagttg
gcccaatgggccttccggaaatggaagtctcatcagtttacttcattacgggacttactc
tggggcaatgccgtgtacctaaaggaggccaatgccatcagtgtggaactgaaaaagaag
gtgcagtttcagtttgttctgctgactgacacactgtactcccctttgcctcctgaatta
cttcccactgagatggaaaaaactcatgaggacaggcctttccctcgcacagtggtagca
gtagaagtccaggatttgaagaatggagcaacacactattggtctttggagaaactcaag
cagaggctggatttgatgcgagagatgtatgatagggcaggggagatggcctccagtgcc
caagacgaaagcgaaaccactgtgactggcagcgatcccttctatgatcggttccactgg
ttcaaacttgtggggagctcccccattttccacggctgtgtgaacgagcgccttgccgac
cgcacaccctcccccactttttccacggccgattccgacatcactgagctggctgacgag
cagcaagatgagatggaggattttgatgatgaggcattcgtggatgacgccggctctgac
gcagggacggaggagggatcagatctcttcagtgacgggcatgacccgttttacgaccga
tccccttggttcattttagtgggaagggcatttgtttacctgagcaatctgctgtatccc
gtgcccctgatccacagggtggccatcgtcagtgagaaaggtgaagtgcggggatttctg
cgtgtggctgtacaggccatcgcagcggatgaagaagctcctgattatggctctggaatt
cgacagtcaggaacagctaaaatatcttttgataatgaatactttaatcagagtgacttt
tcgtctgttgcaatgactcgttctggtctgtccttggaggagttgaggattgtggaagga
cagggtcagagttctgaggtcatcactcctccagaagaaatcagtcgaattaatgacttg
gatttgaagtcaagcactttgctggatggtaagatggtaatggaagggttttctgaagag
attggcaaccacctgaaactgggcagtgccttcactttccgagtaacagtgttgcaggcc
agtggaatcctcccagagtatgcagatatcttctgtcagttcaactttttgcatcgccat
gatgaagcattctccacggagcccctcaaaaacaatggcagaggaagtcccctggccttt
tatcatgtgcagaatattgcagtggagatcactgaatcatttgtggattacatcaaaacc
aagcctattgtatttgaagtctttgggcattatcagcagcacccacttcatctgcaagga
caggagcttaacagtccgcctcagccgtgccgccgattcttccctccacccatgccactg
tccaagccagttccagccaccaagttaaacacgatgagcaaaaccagccttggccagagc
atgagcaagtatgacctcctggtttggtttgagatcagtgaactggagcctacaggagag
tatatcccagctgtggttgaccacacagcaggcttgccttgccaggggacatttttgctt
catcagggcatccagcgaaggatcacagtgaccattatccatgagaaggggagcgagctc
cattggaaagatgttcgtgaactggtggtaggtcgtattcggaataagcctgaggtggat
gaagctgcagttgatgccatcctctccctaaatattatttctgccaagtacctgaagtct
tcccacaactctagcaggaccttctaccgctttgaggctgtgtgggatagctctctgcat
aactcccttcttctgaaccgagtgacaccctatggagaaaagatctacatgaccttgtcg
gcctacctagagctggatcattgcatccagccggctgtcatcaccaaggatgtgtgcatg
gtcttctactcccgagatgccaagatctcaccaccacgctctctgcgtagcctctttggc
agcggctactcaaagtcaccagattcgaatcgagtcactggcatttacgaactcagctta
tgcaaaatgtcagacacaggtagtccaggtatgcagagaaggagaagaaaaatcttagat
acgtcagtggcatatgtgcggggagaagagaacttagcaggctggcggccccgtggagac
agcctcatccttgagcaccagtgggagctggagaagctggagctcctacatgaggtggaa
aaaacccgccactttttgctgctgcgtgagagacttggtgacagcatccccaaatccctg
agcgactcgttatcccccagcctcagcagtgggaccctcagcacctccaccagtatctcc
tctcagatctcaaccactacctttgaaagcgccatcacacctagcgagagcagtggctat
gattcaggagacatcgaaagcctggtggaccgagagaaagagctggctaccaagtgcctg
caacttctcacccacactttcaacagagaattcagccaggtgcacggcagcgtcagtgac
tgtaagttgtctgatatctctccaattggacgggatccctctgagtccagtttcagcagt
gccaccctcactccctcctccacctgtccctctctggtagactctaggagcaactctctg
gatcagaagaccccagaagccaattcccgggcctctagtccctgcccagaatttgaacag
tttcagattgtcccagctgtggaaacaccatatttggcccgagcaggaaaaaacgaattt
ctcaatcttgttccagatattgaagaaattagaccaagctcagtggtctctaagaaagga
taccttcatttcaaggagcctctttacagtaactgggctaaacattttgttgtcgtccgt
cggccttatgtcttcatctataacagtgacaaagaccctgtggagcgtggaatcattaac
ctgtccacagcacaggtggagtacagtgaggaccagcaggccatggtgaagacaccaaac
acctttgctgtctgcacaaagcaccgtggggtccttttgcaggccctcaatgacaaagac
atgaacgactggttgtatgccttcaacccacttctagctggcacaatacggtcaaagctt
tcccgcagatgcccgagccagtcgaaatactaa

DBGET integrated database retrieval system