KEGG   Homo sapiens (human): 23097Help
Entry
23097             CDS       T01001                                 

Gene name
CDK19, CDC2L6, CDK11, bA346C16.3
Definition
(RefSeq) cyclin dependent kinase 19
  KO
K02208  cyclin-dependent kinase 8/11 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    23097 (CDK19)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    23097 (CDK19)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     23097 (CDK19)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     23097 (CDK19)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   23097 (CDK19)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     23097 (CDK19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH
Motif
Other DBs
NCBI-GeneID: 23097
NCBI-ProteinID: NP_055891
OMIM: 614720
HGNC: 19338
Ensembl: ENSG00000155111
Vega: OTTHUMG00000015365
Pharos: Q9BWU1(Tchem)
UniProt: Q9BWU1
Position
6q21
AA seq 502 aa AA seqDB search
MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGIS
MSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKP
MQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKH
KVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLN
EDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTG
AGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQST
LGYSSSSQQSSQYHPSHQAHRY
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggattatgatttcaaggcgaagctggcggcggagcgggagcgggtggaggatttgttt
gagtacgaagggtgcaaagtgggacgcggcacctacggtcacgtctacaaggcgaggcgg
aaagatggaaaagatgaaaaggaatatgcattgaagcaaattgaaggcacaggaatatcc
atgtcggcttgtagagagattgcacttttgcgagaattgaagcaccctaatgtgattgca
ttgcagaaggtgttcctttctcacagtgacaggaaggtatggctgctgtttgattatgca
gagcatgacttgtggcatattattaagtttcaccgtgcatcaaaagcaaataaaaagccc
atgcagttgccaagatctatggttaaatccttactttaccagattcttgatggtatccat
tacctccatgcaaattgggtgcttcacagagacttgaaaccagcaaatatcctagtaatg
ggagaaggtcctgagagggggagagtcaaaatagctgacatgggttttgccagattattc
aattctcctctaaagccactagcagatttggatccagtagttgtgacattttggtatcgg
gctccagaacttttgcttggtgcaaggcattatacaaaggccattgatatatgggcaata
ggttgtatatttgctgaattgttgacttcggaacctatttttcactgtcgtcaggaagat
ataaaaacaagcaatccctttcatcatgatcaactggatcggatatttagtgtcatgggg
tttcctgcagataaagactgggaagatattagaaagatgccagaatatcccacacttcaa
aaagactttagaagaacaacgtatgccaacagtagcctcataaagtacatggagaaacac
aaggtcaagcctgacagcaaagtgttcctcttgcttcagaaactcctgaccatggatcca
accaagagaattacctcggagcaagctctgcaggatccctattttcaggaggaccctttg
ccaacattagatgtatttgccggctgccagattccataccccaaacgagaattccttaat
gaagatgatcctgaagaaaaaggtgacaagaatcagcaacagcagcagaaccagcatcag
cagcccacagcccctccacagcaggcagcagcccctccacaggcgcccccaccacagcag
aacagcacccagaccaacgggaccgcaggtggggctggggccggggtcgggggcaccgga
gcagggttgcagcacagccaggactccagcctgaaccaggtgcctccaaacaagaagcca
cggctagggccttcaggcgcaaactcaggtggacctgtgatgccctcggattatcagcac
tccagttctcgcctgaattaccaaagcagcgttcagggatcctctcagtcccagagcaca
cttggctactcttcctcgtctcagcagagctcacagtaccacccatctcaccaggcccac
cggtactga

DBGET integrated database retrieval system