KEGG   Homo sapiens (human): 23098Help
Entry
23098             CDS       T01001                                 

Gene name
SARM1, MyD88-5, SAMD2, SARM
Definition
(RefSeq) sterile alpha and TIR motif containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SAM_2 SAM_1 TIR_2 SAM_3 SAM_PNT HEAT_2 Carb_kinase
Motif
Other DBs
NCBI-GeneID: 23098
NCBI-ProteinID: NP_055892
OMIM: 607732
HGNC: 17074
Ensembl: ENSG00000004139
Vega: OTTHUMG00000132499
Pharos: Q6SZW1(Tbio)
UniProt: Q6SZW1 Q05B42 Q0D2N8
Structure
PDB: 

Position
17q11.2
AA seq 724 aa AA seqDB search
MVLTLLLSAYKLCRFFAMSGPRPGAERLAVPGPDGGGGTGPWWAAGGRGPREVSPGAGTE
VQDALERALPELQQALSALKQAGGARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAI
RLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVEL
ARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALGNCALHGGQA
VQRRMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVERSGTLALVEPLV
ASLDPGRFARCLVDASDTSQGRGPDDLQRLVPLLDSNRLEAQCIGAFYLCAEAAIKSLQG
KTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTW
LQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYS
TCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILT
AAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEA
GKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGF
EWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLEGAAP
MGPT
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgacgctgcttctctccgcctacaagctgtgtcgcttcttcgccatgtcgggc
ccacggccgggcgccgagcggctggcggtgcctgggccagatgggggcggtggcacgggc
ccatggtgggctgcgggtggccgcgggccccgcgaagtgtcgccgggggcaggcaccgag
gtgcaggacgccctggagcgcgcgctgccggagctgcagcaggccttgtccgcgctgaag
caggcgggcggcgcgcgggccgtgggcgccggcctggccgaggtcttccaactggtggag
gaggcctggctgctgccggccgtgggccgcgaggtagcccagggtctgtgcgacgccatc
cgcctcgatggcggcctcgacctgctgttgcggctgctgcaggcgccggagttggagacg
cgtgtgcaggccgcgcgcctgctggagcagatcctggtggctgagaaccgagaccgcgtg
gcgcgcattgggctgggcgtgatcctgaacctggcgaaggaacgcgaacccgtagagctg
gcgcggagcgtggcaggcatcttggagcacatgttcaagcattcggaggagacatgccag
aggctggtggcggccggcggcctggacgcggtgctgtattggtgccgccgcacggacccc
gcgctgctgcgccactgcgcgctggcgctgggcaactgcgcgctgcacgggggccaggcg
gtgcagcgacgcatggtagagaagcgcgcagccgagtggctcttcccgctcgccttctcc
aaggaggacgagctgcttcggctgcacgcctgcctcgcagtagcggtgttggcgactaac
aaggaggtggagcgcgaggtggagcgctcgggcacgctggcgctcgtggagccgcttgtg
gcctcgctggaccctggccgcttcgcccgctgtctggtggacgccagcgacacaagccag
ggccgcgggcccgacgacctgcagcgcctcgtgccgttgctcgactctaaccgcttggag
gcgcagtgcatcggggctttctacctctgcgccgaggctgccatcaagagcctgcaaggc
aagaccaaggtgttcagcgacatcggcgccatccagagcctgaaacgcctggtttcctac
tctaccaatggcactaagtcggcgctggccaagcgcgcgctgcgcctgctgggcgaggag
gtgccacggcccatcctgccctccgtgcccagctggaaggaggccgaggttcagacgtgg
ctgcagcagatcggtttctccaagtactgcgagagcttccgggagcagcaggtggatggc
gacctgcttctgcggctcacggaggaggaactccagaccgacctgggcatgaaatcgggc
atcacccgcaagaggttctttagggagctcacggagctcaagaccttcgccaactattct
acgtgcgaccgcagcaacctggcggactggctgggcagcctggacccgcgcttccgccag
tacacctacggcctggtcagctgcggcctggaccgctccctgctgcaccgcgtgtctgag
cagcagctgctggaagactgcggcatccacctgggcgtgcaccgcgcccgcatcctcacg
gcggccagagaaatgctacactccccgctgccctgtactggtggcaaacccagtggggac
actccagatgtcttcatcagctaccgccggaactcaggttcccagctggccagtctcctg
aaggtgcacctgcagctgcatggcttcagtgtcttcattgatgtggagaagctggaagca
ggcaagttcgaggacaaactcatccagagtgtcatgggtgcccgcaactttgtgttggtg
ctatcacctggagcactggacaagtgcatgcaagaccatgactgcaaggattgggtgcat
aaggagattgtgactgctttaagctgcggcaagaacattgtgcccatcattgatggcttc
gagtggcctgagccccaggtcctgcctgaggacatgcaggctgtgcttactttcaacggt
atcaagtggtcccacgaataccaggaggccaccattgagaagatcatccgcttcctgcag
ggccgctcctcccgggactcatctgcaggctctgacaccagtttggagggtgctgcaccc
atgggtccaacctaa

DBGET integrated database retrieval system