KEGG   Homo sapiens (human): 231Help
Entry
231               CDS       T01001                                 

Gene name
AKR1B1, ADR, ALDR1, ALR2, AR
Definition
(RefSeq) aldo-keto reductase family 1 member B
  KO
K00011  aldehyde reductase [EC:1.1.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00051  Fructose and mannose metabolism
hsa00052  Galactose metabolism
hsa00561  Glycerolipid metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
Drug target
Alrestatin sodium: D02835
Epalrestat: D01688
Fidarestat: D01842
Lidorestat: D03803
Minalrestat: D03805
Ponalrestat: D03806
Ranirestat: D06403
Risarestat: D01715
Sorbinil: D05893
Tolrestat: D02323
Zenarestat: D03807
Zopolrestat: D02328
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    231 (AKR1B1)
   00051 Fructose and mannose metabolism
    231 (AKR1B1)
   00052 Galactose metabolism
    231 (AKR1B1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    231 (AKR1B1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    231 (AKR1B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldehyde reductase
     231 (AKR1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 231
NCBI-ProteinID: NP_001619
OMIM: 103880
HGNC: 381
Ensembl: ENSG00000085662
Vega: OTTHUMG00000155322
Pharos: P15121(Tclin)
UniProt: P15121 A0A024R7A8
Structure
PDB: 

Position
7q33
AA seq 316 aa AA seqDB search
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccgtctcctgctcaacaacggcgccaagatgcccatcctggggttgggtacc
tggaagtcccctccagggcaggtgactgaggccgtgaaggtggccattgacgtcgggtac
cgccacatcgactgtgcccatgtgtaccagaatgagaatgaggtgggggtggccattcag
gagaagctcagggagcaggtggtgaagcgtgaggagctcttcatcgtcagcaagctgtgg
tgcacgtaccatgagaagggcctggtgaaaggagcctgccagaagacactcagcgacctg
aagctggactacctggacctctaccttattcactggccgactggctttaagcctgggaag
gaatttttcccattggatgagtcgggcaatgtggttcccagtgacaccaacattctggac
acgtgggcggccatggaagagctggtggatgaagggctggtgaaagctattggcatctcc
aacttcaaccatctccaggtggagatgatcttaaacaaacctggcttgaagtataagcct
gcagttaaccagattgagtgccacccatatctcactcaggagaagttaatccagtactgc
cagtccaaaggcatcgtggtgaccgcctacagccccctcggctctcctgacaggccctgg
gccaagcccgaggacccttctctcctggaggatcccaggatcaaggcgatcgcagccaag
cacaataaaactacagcccaggtcctgatccggttccccatgcagaggaacttggtggtg
atccccaagtctgtgacaccagaacgcattgctgagaactttaaggtctttgactttgaa
ctgagcagccaggatatgaccaccttactcagctacaacaggaactggagggtctgtgcc
ttgttgagctgtacctcccacaaggattaccccttccatgaagagttttga

KEGG   Homo sapiens (human): 57016Help
Entry
57016             CDS       T01001                                 

Gene name
AKR1B10, AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI
Definition
(RefSeq) aldo-keto reductase family 1 member B10
  KO
K00011  aldehyde reductase [EC:1.1.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00051  Fructose and mannose metabolism
hsa00052  Galactose metabolism
hsa00561  Glycerolipid metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    57016 (AKR1B10)
   00051 Fructose and mannose metabolism
    57016 (AKR1B10)
   00052 Galactose metabolism
    57016 (AKR1B10)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    57016 (AKR1B10)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    57016 (AKR1B10)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldehyde reductase
     57016 (AKR1B10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red HU-CCDC81_euk_1
Motif
Other DBs
NCBI-GeneID: 57016
NCBI-ProteinID: NP_064695
OMIM: 604707
HGNC: 382
Ensembl: ENSG00000198074
Vega: OTTHUMG00000155356
Pharos: O60218(Tchem)
UniProt: O60218
Structure
PDB: 

Position
7q33
AA seq 316 aa AA seqDB search
MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtttgtggagctcagtaccaaagccaagatgcccattgtgggcctgggcact
tggaagtctcctcttggcaaagtgaaagaagcagtgaaggtggccattgatgcaggatat
cggcacattgactgtgcctatgtctatcagaatgaacatgaagtgggggaagccatccaa
gagaagatccaagagaaggctgtgaagcgggaggacctgttcatcgtcagcaagttgtgg
cccactttctttgagagaccccttgtgaggaaagcctttgagaagaccctcaaggacctg
aagctgagctatctggacgtctatcttattcactggccacagggattcaagtctggggat
gaccttttccccaaagatgataaaggtaatgccatcggtggaaaagcaacgttcttggat
gcctgggaggccatggaggagctggtggatgaggggctggtgaaagcccttggggtctcc
aatttcagccacttccagatcgagaagctcttgaacaaacctggactgaaatataaacca
gtgactaaccaggttgagtgtcacccatacctcacacaggagaaactgatccagtactgc
cactccaagggcatcaccgttacggcctacagccccctgggctctccggatagaccttgg
gccaagccagaagacccttccctgctggaggatcccaagattaaggagattgctgcaaag
cacaaaaaaaccgcagcccaggttctgatccgtttccatatccagaggaatgtgattgtc
atccccaagtctgtgacaccagcacgcattgttgagaacattcaggtctttgactttaaa
ttgagtgatgaggagatggcaaccatactcagcttcaacagaaactggagggcctgtaac
gtgttgcaatcctctcatttggaagactatcccttcaatgcagaatattga

DBGET integrated database retrieval system