KEGG   Homo sapiens (human): 23112
Entry
23112             CDS       T01001                                 

Gene name
TNRC6B
Definition
(RefSeq) trinucleotide repeat containing adaptor 6B
  KO
K18412  trinucleotide repeat-containing gene 6 protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23112 (TNRC6B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    23112 (TNRC6B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     23112 (TNRC6B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    23112 (TNRC6B)
SSDB
Motif
Pfam: TNRC6-PABC_bdg Ago_hook RRM_occluded RRM_1
Other DBs
NCBI-GeneID: 23112
NCBI-ProteinID: NP_001155973
OMIM: 610740
HGNC: 29190
Ensembl: ENSG00000100354
Vega: OTTHUMG00000151114
Pharos: Q9UPQ9(Tbio)
UniProt: Q9UPQ9
Position
22q13.1
AA seq 1833 aa
MREKEQEREEQLMEDKKRKKEDKKKKEATQKVTEQKTKVPEVTKPSLSQPTAASPIGSSP
SPPVNGGNNAKRVAVPNGQPPSAARYMPREVPPRFRCQQDHKVLLKRGQPPPPSCMLLGG
GAGPPPCTAPGANPNNAQVTGALLQSESGTAPDSTLGGAAASNYANSTWGSGASSNNGTS
PNPIHIWDKVIVDGSDMEEWPCIASKDTESSSENTTDNNSASNPGSEKSTLPGSTTSNKG
KGSQCQSASSGNECNLGVWKSDPKAKSVQSSNSTTENNNGLGNWRNVSGQDRIGPGSGFS
NFNPNSNPSAWPALVQEGTSRKGALETDNSNSSAQVSTVGQTSREQQSKMENAGVNFVVS
GREQAQIHNTDGPKNGNTNSLNLSSPNPMENKGMPFGMGLGNTSRSTDAPSQSTGDRKTG
SVGSWGAARGPSGTDTVSGQSNSGNNGNNGKEREDSWKGASVQKSTGSKNDSWDNNNRST
GGSWNFGPQDSNDNKWGEGNKMTSGVSQGEWKQPTGSDELKIGEWSGPNQPNSSTGAWDN
QKGHPLPENQGNAQAPCWGRSSSSTGSEVGGQSTGSNHKAGSSDSHNSGRRSYRPTHPDC
QAVLQTLLSRTDLDPRVLSNTGWGQTQIKQDTVWDIEEVPRPEGKSDKGTEGWESAATQT
KNSGGWGDAPSQSNQMKSGWGELSASTEWKDPKNTGGWNDYKNNNSSNWGGGRPDEKTPS
SWNENPSKDQGWGGGRQPNQGWSSGKNGWGEEVDQTKNSNWESSASKPVSGWGEGGQNEI
GTWGNGGNASLASKGGWEDCKRSPAWNETGRQPNSWNKQHQQQQPPQQPPPPQPEASGSW
GGPPPPPPGNVRPSNSSWSSGPQPATPKDEEPSGWEEPSPQSISRKMDIDDGTSAWGDPN
SYNYKNVNLWDKNSQGGPAPREPNLPTPMTSKSASVWSKSTPPAPDNGTSAWGEPNESSP
GWGEMDDTGASTTGWGNTPANAPNAMKPNSKSMQDGWGESDGPVTGARHPSWEEEEDGGV
WNTTGSQGSASSHNSASWGQGGKKQMKCSLKGGNNDSWMNPLAKQFSNMGLLSQTEDNPS
SKMDLSVGSLSDKKFDVDKRAMNLGDFNDIMRKDRSGFRPPNSKDMGTTDSGPYFEKLTL
PFSNQDGCLGDEAPCSPFSPSPSYKLSPSGSTLPNVSLGAIGTGLNPQNFAARQGGSHGL
FGNSTAQSRGLHTPVQPLNSSPSLRAQVPPQFISPQVSASMLKQFPNSGLSPGLFNVGPQ
LSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSAL
QQQQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGM
DYGMVGGKEAGTESRFKQWTSMMEGLPSVATQEANMHKNGAIVAPGKTRGGSPYNQFDII
PGDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSNASWPPEFQPGVPWKGIQNIDPESDPYV
TPGSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSPGAWPYSASDNSFTNVHSTSA
KFPDYKSTWSPDPIGHNPTHLSNKMWKNHISSRNTTPLPRPPPGLTNPKPSSPWSSTAPR
SVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLN
LTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPS
APAAGWQSLETGQNQSDPVGPALNLFGGSTGLGQWSSSAGGSSGADLAGASLWGPPNYSS
SLWGVPTVEDPHRMGSPAPLLPGDLLGGGSDSI
NT seq 5502 nt   +upstreamnt  +downstreamnt
atgagagagaaggagcaagaaagggaagaacagttaatggaagacaagaaaaggaagaaa
gaggataaaaagaaaaaagaagccactcagaaggtcacggaacaaaaaaccaaagtgccc
gaagtgacgaaaccaagtttaagccaaccaacggccgccagcccaattggcagctctcca
tcgccaccagtcaatggtggcaacaatgccaaaagggtggcagtgccgaacggacaaccg
ccaagcgccgcccgctacatgcctcgggaggtgccgccgcgattccgttgccagcaggac
cacaaagtgttactaaaacgtgggcagccccctccaccgtcctgcatgctccttgggggt
ggggcagggcctcctccctgcacagcacctggagcaaacccaaacaacgcacaagtgaca
ggagcgctgctgcagagtgagagtgggactgcgccagactcaacccttggaggtgctgct
gcttcaaattatgcaaattccacttggggctcgggagcctcctccaacaacggcacctcc
cccaacccaattcacatctgggacaaggtgattgtagacgggtctgacatggaagagtgg
ccttgtattgccagcaaagacactgaatcttcttccgaaaacaccaccgataacaacagt
gcctcgaaccctggctctgagaagagcactctgccaggaagcaccactagtaacaaagga
aaagggagccagtgccagtctgcaagttctgggaacgaatgtaatcttggggtctggaaa
tctgaccctaaggctaaatctgttcaatcttccaactctactacagagaacaacaatgga
ctaggaaattggaggaatgtgagtggtcaggatagaattggacctggctctggcttcagc
aactttaacccaaatagcaacccatctgcctggccagcactggtccaagaaggaacttct
aggaaaggggcattggaaacagataatagtaattccagtgcacaggttagcacagtaggt
cagacatccagggaacagcagtcaaagatggaaaatgcgggtgttaattttgttgtctct
ggcagagaacaggctcaaattcataacactgatggaccaaaaaatggaaacactaactcc
ttgaacttaagttcaccaaaccccatggagaataagggaatgccctttggaatgggcttg
gggaacacctccaggagcactgatgccccttcacaaagcactggagatcgaaagactggg
agtgttggatcttggggtgcagctagggggccttctggaactgacacagtctctggacaa
agcaattctggaaacaatgggaacaatggaaaagagagagaggactcctggaaaggagct
tctgttcagaaatcaactgggtcaaaaaatgactcttgggacaacaataacaggtctacg
ggtgggtcctggaactttggcccccaggactctaatgacaacaaatggggtgaagggaac
aaaatgacatctggggtctctcagggagaatggaaacagccgactgggtctgatgagttg
aaaattggagaatggagtggtccaaaccaaccaaattctagcactggagcatgggacaat
caaaagggccaccccctccctgaaaaccaaggcaatgcccaggctccctgttggggaaga
tcttccagctccacaggaagtgaagttggaggtcaaagcactggaagcaaccacaaagca
ggaagtagtgacagtcataactctggccgtcggtcgtacaggcccacacatcctgattgt
caggctgtcttgcagactcttttgagccgaactgatttggaccccagggtgctctcaaac
actggctggggccaaactcaaattaagcaggacacagtgtgggacattgaagaggtgcca
aggcctgaggggaaatctgacaaaggaactgaggggtgggagagcgctgccacacagacc
aagaactcagggggctggggagatgcacccagccaaagcaatcaaatgaagtctggatgg
ggggagctctcagcctctacagagtggaaagaccccaagaacacaggaggctggaatgac
tacaagaacaacaactcttccaactggggaggaggacgacctgatgaaaagacaccttcc
tcttggaatgagaatcccagcaaggatcaggggtggggaggtggacgccagcccaatcaa
ggatggtcttctggaaagaatggttggggggaggaagtcgatcagacaaaaaacagcaat
tgggaaagttctgcaagtaaacctgtgtctgggtggggtgaaggagggcagaatgaaatc
gggacttggggtaatggtggcaatgcaagcctagcttcaaaaggtgggtgggaggattgc
aaaagatccccagcatggaatgagacgggccgacagcccaattcctggaataaacaacac
caacagcagcagcccccacagcagccgccgccaccacaaccagaggcttctggttcgtgg
ggaggcccacccccaccacctccaggcaacgttcgaccttccaattccagctggagcagc
gggccacagcctgcaacacctaaggatgaggaacccagtggttgggaagagccatcccca
cagtcaattagtcggaaaatggacattgatgatggcacttcagcatggggagaccctaac
agttataactacaagaatgtgaatctgtgggataagaattcccaagggggcccagcacct
cgagaaccaaacctgcccaccccaatgaccagtaaatcggcatcagtctggagcaaaagc
acaccacctgctccagataatggtacttccgcttggggtgagccaaatgaaagcagtcct
gggtggggcgagatggatgatacaggagcatcgaccacaggctgggggaacacgcccgcc
aacgctcccaatgccatgaagcctaattccaaatctatgcaagacggctggggggagagt
gacgggccagtcacaggagctcgccatcccagctgggaagaggaggaggatggaggagtc
tggaacaccactggctctcagggcagtgcttcctcccacaactcagcaagctggggacaa
ggaggaaagaaacaaatgaagtgctcactcaaaggaggaaacaatgattcatggatgaat
cctcttgccaaacagttttcaaatatgggattgctgagtcagactgaagataatccaagc
agcaaaatggatttgtctgtaggaagcctttcagataaaaaatttgatgtggacaagcga
gcgatgaatctcggggattttaatgatatcatgaggaaggatcgatctgggttccgtcca
cctaattccaaagacatgggaaccacagatagtgggccttattttgagaagctgactttg
cctttctccaatcaagatgggtgccttggggatgaggctccctgctctcccttctcccct
tctcccagctacaagctgtctccctctggttccacactacccaacgtcagccttggagca
atcggcacagggctcaacccccaaaacttcgctgctagacaaggcggtagtcatggtttg
tttggaaacagcacagcacaatcgagaggtctgcacacacccgtgcagccactaaattct
tctcccagtctccgggcgcaagtgcctccccagtttatttccccccaggtttctgcctca
atgctcaagcagtttcccaacagtggcctgagtccaggtcttttcaatgtggggccccag
ttatctcctcaacaaattgccatgctgagccagcttccacaaattccccagtttcagttg
gcatgtcagcttctcttgcagcagcagcaacagcagcagttgttacagaaccagagaaag
atttctcaagctgtacgccaacagcaagagcagcagctggctcgaatggtgagtgcactg
cagcagcagcagcagcagcagcagaggcagccaggcatgaagcactcgccctctcatcct
gttgggcccaagccgcatctggacaacatggtacccaacgcattgaatgtggggctccca
gaccttcaaaccaaagggccaatacctggatatggttctggcttcagctctggcggcatg
gactatggcatggttggtgggaaggaggctggaaccgagtctcgctttaaacagtggacc
tccatgatggaggggctgccctctgtagccacacaggaagccaatatgcacaaaaatggc
gctatagtggcccctggtaaaacccggggagggtcaccgtacaaccagtttgatatcatc
cctggtgacacactgggtggccatacgggtcctgctggtgatagctggttacctgccaaa
tctccaccaacaaataaaatcggaagtaaatccagcaatgccagttggcctccagaattc
caaccaggagtgccatggaaaggtatccaaaacattgaccctgaatctgacccctatgtc
accccaggaagtgtgctggggggtacagccacatctcccattgtagatactgaccaccaa
ctgctgcgggataacaccacagggtctaattcttccctcaacacctcgctgccttcacct
ggtgcctggccctacagtgcctctgacaactcctttaccaacgttcatagcacttcagca
aagttccctgattacaaatcaacatggtccccagatcccataggacacaaccccactcat
ctctccaacaagatgtggaaaaaccatatttcctccaggaacactacaccgctgccccgc
ccacctcctggtctgaccaaccccaaaccatcatctccctggagcagcacagcaccccga
tcagtcagggggtgggggacacaggactcacggctcgcctcggcctctacctggagtgat
ggtggctcagttcgtcctagttactggctggttcttcacaatctcaccccacagattgat
gggtcaaccttgagaacgatctgcatgcagcatggcccactgctgacattccatctgaat
ctaacccagggcactgccctgatccgatacagcaccaaacaggaggcggccaaggcccaa
actgcactgcacatgtgtgtgttgggaaacactaccatccttgctgagtttgccactgat
gatgaagtcagccgctttctggcacaagctcagccccctacacctgcagcaaccccaagt
gcgccagctgcggggtggcagtcgctggagaccggccagaaccagtcagatcccgtggga
cctgctctgaatctttttggtgggtccactgggctcgggcagtggagcagcagcgctggt
ggcagcagcggggccgatcttgctggcgcttcattgtgggggcccccaaactattcttct
agcttatggggagtcccaacggtggaagatccccataggatgggcagccctgctccttta
ctacctggtgaccttctgggaggagggtcggattcaatctga

DBGET integrated database retrieval system