KEGG   Homo sapiens (human): 23118Help
Entry
23118             CDS       T01001                                 

Gene name
TAB2, CHTD2, MAP3K7IP2, TAB-2
Definition
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
Module
hsa_M00686  Toll-like receptor signaling
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    23118 (TAB2)
   04064 NF-kappa B signaling pathway
    23118 (TAB2)
   04668 TNF signaling pathway
    23118 (TAB2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    23118 (TAB2)
   04621 NOD-like receptor signaling pathway
    23118 (TAB2)
   04657 IL-17 signaling pathway
    23118 (TAB2)
  09158 Development
   04380 Osteoclast differentiation
    23118 (TAB2)
 09160 Human Diseases
  09167 Infectious diseases
   05162 Measles
    23118 (TAB2)
   05168 Herpes simplex infection
    23118 (TAB2)
   05169 Epstein-Barr virus infection
    23118 (TAB2)
   05145 Toxoplasmosis
    23118 (TAB2)
   05140 Leishmaniasis
    23118 (TAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUE zf-RanBP Mnd1 IncA DivIC
Motif
Other DBs
NCBI-GeneID: 23118
NCBI-ProteinID: NP_001278963
OMIM: 605101
HGNC: 17075
Ensembl: ENSG00000055208 ENSG00000228408
Vega: OTTHUMG00000015783
Pharos: Q9NYJ8(Tbio)
UniProt: Q9NYJ8
Structure
PDB: 

Position
6q25.1
AA seq 693 aa AA seqDB search
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSE
LFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaaattc
cctgaagtacctgaagttgttgtatccaggtgcatgttacagaataataataacctggat
gcctgctgtgctgttctctctcaggagagtacaagatatctttatggtgaaggagacttg
aatttttcagatgattctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcaatcacagaacatttaccaccatggaagagaaggaagtaggatgaatggaagt
aggactctaacgcacagcattagtgatggacaacttcaaggtggccagtccaatagtgaa
ctatttcagcaggagccacagacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgtccagttcctctggtgcttcaaattcagcaccacatcttggatttcacttaggc
agcaaaggaacatctagcctttctcaacaaactcccagatttaatcccattatggtaact
ttagccccaaatatccagactggtcgtaatactcctacatctttgcacatacatggtgta
cctccacctgtacttaacagtccacagggaaattctatctatattaggccttacattaca
actcctggtggtacaactcgacagacacaacagcattctggctgggtatctcagtttaat
cccatgaaccctcagcaagtttatcagccttcacagcctggtccctggactacttgtcct
gcatctaatcctctgtcacatacctcatctcaacagccaaatcagcaaggccaccagacc
tctcatgtctacatgccaatcagttcacctactacttcacaaccaccaaccattcattca
tctggtagctcacagtcttctgcccatagccaatataacattcagaatatttcaacagga
cctcgaaaaaaccagattgaaatcaaacttgaacccccacaaagaaataattcttcaaaa
ctgcgttcttctggacctcgaacctccagcacttcctcttcagtcaatagccagacctta
aacagaaatcagcccactgtttacatagctgccagccccccaaatacggatgagctgatg
tcccgtagtcaacctaaggtctatatttcagcgaatgctgccacaggagatgaacaggtc
atgcggaatcagcccacactcttcatatccacaaactctggagcatctgctgcctccagg
aacatgtctgggcaagtgagcatgggtcctgcctttattcatcaccatcctcccaaaagt
cgagcaataggcaataactctgcaacctctcctcgagtggtagtcactcagcccaatacg
aaatacactttcaaaattacagtctctcccaataagccccctgcagtttcaccaggggtg
gtgtcccctacctttgaacttacaaatcttcttaatcatcctgatcattatgtagaaacc
gagaatattcagcacctcacggaccctacattagcacatgtggatagaataagtgaaaca
cggaaactgagtatgggatctgatgatgctgcctacacacaagctcttttggtacaccag
aaggccagaatggaacgacttcaaagagaacttgagattcaaaagaaaaagctggataaa
ttaaaatctgaggttaatgaaatggaaaataatctaactcgaaggcgcctgaaaagatca
aattctatatcccagataccttcccttgaagaaatgcagcagctgagaagttgtaataga
caactccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgagga
ccacattttaaccccagcgctattcataacttttatgacaatattggatttgtaggtcct
gtgccaccaaaacccaaagatcaaaggtccatcatcaaaacaccaaagactcaagacaca
gaagatgatgagggagctcagtggaattgtaccgcctgtacttttttgaaccatccagcc
ttaattcgctgtgaacagtgtgagatgccaaggcatttctga

DBGET integrated database retrieval system