KEGG   Homo sapiens (human): 23118
Entry
23118             CDS       T01001                                 

Symbol
TAB2, CHTD2, MAP3K7IP2, TAB-2
Name
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04936  Alcoholic liver disease
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05417  Lipid and atherosclerosis
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06223  TNF signaling
nt06263  Hepatocellular carcinoma
nt06416  TNF signaling
nt06461  Huntington disease
  Element
N00151  TNF-NFKB signaling pathway
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00562  HSV US3 to TLR2/4-NFKB signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
N00927  Escherichia/Shigella NleE/OspZ to TNF-NFKB signaling pathway
Disease
H02199  Congenital heart defects, multiple type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    23118 (TAB2)
   04064 NF-kappa B signaling pathway
    23118 (TAB2)
   04668 TNF signaling pathway
    23118 (TAB2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    23118 (TAB2)
   04621 NOD-like receptor signaling pathway
    23118 (TAB2)
   04657 IL-17 signaling pathway
    23118 (TAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    23118 (TAB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    23118 (TAB2)
   05161 Hepatitis B
    23118 (TAB2)
   05171 Coronavirus disease - COVID-19
    23118 (TAB2)
   05162 Measles
    23118 (TAB2)
   05168 Herpes simplex virus 1 infection
    23118 (TAB2)
   05169 Epstein-Barr virus infection
    23118 (TAB2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    23118 (TAB2)
   05132 Salmonella infection
    23118 (TAB2)
   05131 Shigellosis
    23118 (TAB2)
   05135 Yersinia infection
    23118 (TAB2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    23118 (TAB2)
   05140 Leishmaniasis
    23118 (TAB2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    23118 (TAB2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    23118 (TAB2)
SSDB
Motif
Pfam: CUE zf-RanBP DivIC
Other DBs
NCBI-GeneID: 23118
NCBI-ProteinID: NP_001278963
OMIM: 605101
HGNC: 17075
Ensembl: ENSG00000055208 ENSG00000228408
Vega: OTTHUMG00000015783
Pharos: Q9NYJ8(Tbio)
UniProt: Q9NYJ8
Structure
PDB: 
2WWZ 2WX0 2WX1 2DAE

Position
6q25.1
AA seq 693 aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSE
LFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaaattc
cctgaagtacctgaagttgttgtatccaggtgcatgttacagaataataataacctggat
gcctgctgtgctgttctctctcaggagagtacaagatatctttatggtgaaggagacttg
aatttttcagatgattctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcaatcacagaacatttaccaccatggaagagaaggaagtaggatgaatggaagt
aggactctaacgcacagcattagtgatggacaacttcaaggtggccagtccaatagtgaa
ctatttcagcaggagccacagacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgtccagttcctctggtgcttcaaattcagcaccacatcttggatttcacttaggc
agcaaaggaacatctagcctttctcaacaaactcccagatttaatcccattatggtaact
ttagccccaaatatccagactggtcgtaatactcctacatctttgcacatacatggtgta
cctccacctgtacttaacagtccacagggaaattctatctatattaggccttacattaca
actcctggtggtacaactcgacagacacaacagcattctggctgggtatctcagtttaat
cccatgaaccctcagcaagtttatcagccttcacagcctggtccctggactacttgtcct
gcatctaatcctctgtcacatacctcatctcaacagccaaatcagcaaggccaccagacc
tctcatgtctacatgccaatcagttcacctactacttcacaaccaccaaccattcattca
tctggtagctcacagtcttctgcccatagccaatataacattcagaatatttcaacagga
cctcgaaaaaaccagattgaaatcaaacttgaacccccacaaagaaataattcttcaaaa
ctgcgttcttctggacctcgaacctccagcacttcctcttcagtcaatagccagacctta
aacagaaatcagcccactgtttacatagctgccagccccccaaatacggatgagctgatg
tcccgtagtcaacctaaggtctatatttcagcgaatgctgccacaggagatgaacaggtc
atgcggaatcagcccacactcttcatatccacaaactctggagcatctgctgcctccagg
aacatgtctgggcaagtgagcatgggtcctgcctttattcatcaccatcctcccaaaagt
cgagcaataggcaataactctgcaacctctcctcgagtggtagtcactcagcccaatacg
aaatacactttcaaaattacagtctctcccaataagccccctgcagtttcaccaggggtg
gtgtcccctacctttgaacttacaaatcttcttaatcatcctgatcattatgtagaaacc
gagaatattcagcacctcacggaccctacattagcacatgtggatagaataagtgaaaca
cggaaactgagtatgggatctgatgatgctgcctacacacaagctcttttggtacaccag
aaggccagaatggaacgacttcaaagagaacttgagattcaaaagaaaaagctggataaa
ttaaaatctgaggttaatgaaatggaaaataatctaactcgaaggcgcctgaaaagatca
aattctatatcccagataccttcccttgaagaaatgcagcagctgagaagttgtaataga
caactccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgagga
ccacattttaaccccagcgctattcataacttttatgacaatattggatttgtaggtcct
gtgccaccaaaacccaaagatcaaaggtccatcatcaaaacaccaaagactcaagacaca
gaagatgatgagggagctcagtggaattgtaccgcctgtacttttttgaaccatccagcc
ttaattcgctgtgaacagtgtgagatgccaaggcatttctga

KEGG   Homo sapiens (human): 257397
Entry
257397            CDS       T01001                                 

Symbol
TAB3, MAP3K7IP3, NAP1
Name
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 3
  KO
K12793  TAK1-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04936  Alcoholic liver disease
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06211  Other MAPK signaling
nt06223  TNF signaling
nt06263  Hepatocellular carcinoma
  Element
N00151  TNF-NFKB signaling pathway
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00927  Escherichia/Shigella NleE/OspZ to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    257397 (TAB3)
   04668 TNF signaling pathway
    257397 (TAB3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    257397 (TAB3)
   04657 IL-17 signaling pathway
    257397 (TAB3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    257397 (TAB3)
   05132 Salmonella infection
    257397 (TAB3)
   05131 Shigellosis
    257397 (TAB3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    257397 (TAB3)
SSDB
Motif
Pfam: CUE zf-RanBP Tmemb_cc2
Other DBs
NCBI-GeneID: 257397
NCBI-ProteinID: NP_690000
OMIM: 300480
HGNC: 30681
Ensembl: ENSG00000157625
Vega: OTTHUMG00000021329
Pharos: Q8N5C8(Tbio)
UniProt: Q8N5C8
Position
Xp21.2
AA seq 712 aa
MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHS
PDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICL
VQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPP
PPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSSS
GRQTPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSAYHSPPPSQC
PSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAYLPYTASSLSK
GSMKKIEITVEPSQRPGTAINRSPSPISNQPSPRNQHSLYTATTPPSSSPSRGISSQPKP
PFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAP
EPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEEL
ERLKSEVNGMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQS
RGNFDPKAMNNFYDNIEPGPVVPPKPSKKDSSDPCTIERKARRISVTSKVQADIHDTQAA
AADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggcgcaaagcagcccacagcttgatattcaggttctccatgatcttcgacaacgtttc
cctgaaattccagagggcgtggtgtctcagtgcatgttacagaataacaacaatcttgaa
gcctgttgccgagccctttcccaggagagtagcaaatacttatatatggaataccatagt
ccagatgacaataggatgaatagaaatcgccttttacatattaacctgggtatccattct
cctagtagctatcacccaggagatggagcccaacttaatggtggtcgaacactggtacat
agctcaagtgatggacatattgatcctcagcatgcagcaggtaaacagctgatatgttta
gttcaagaaccacactcagctccagctgttgttgctgctactcccaactacaatccattt
tttatgaacgaacagaacagaagtgcagctactcctccttcacaaccacctcaacagcca
tcttccatgcaaacaggaatgaatccgtctgctatgcaagggccttcaccaccaccgcca
cctccttcatacatgcacatacctcggtatagtacaaatccaattactgttacagtatcc
cagaacctcccttctggacagactgtaccaagagctttacaaattcttccacaaattcca
agcaatctctatgggtctcctggttctatttatattagacagacatctcagagttcatca
ggaagacaaactcctcagagtacgccgtggcagtcctcaccacagggcccagtgcctcac
tatagccagcgtcctttacctgtttatccacaccaacagaactatcagccttctcagtat
tctcccaaacagcagcagatccctcagtctgcttaccattcaccacctccttctcaatgt
ccttcacccttcagctctccacagcatcaagtgcaaccttcccagttgggccacatcttt
atgccacctagtccttcaactactccaccccatccatatcaacaaggacctcctagctat
cagaaacagggaagccattcagtagcctatcttccatacacagcatctagtttatccaaa
ggttccatgaagaagatagaaattacagttgaaccttctcaaagacctgggacagcaatt
aataggagtccttcacccatcagtaatcaaccatctccacggaatcaacactcactgtac
acagccaccacgccaccttcaagttctccttcaagagggatatctagtcaaccaaaacct
ccatttagtgttaatcctgtgtatattacatatacacagccaactggaccttcttgtact
ccatcaccatctcctcgagtgataccaaacccaactacagtttttaaaattaccgtaggc
cgagcaacgactgaaaatcttttaaatttagtggaccaagaagagcgctctgcagcacca
gaacctattcagcccatttcagtgataccaggctctgggggagaaaagggaagccataaa
tatcagagaagttctagttctggatcagatgactatgcctacacacaagccttgctgtta
catcaacgagcaaggatggagaggttagcaaagcaactgaaacttgagaaagaggagcta
gagcggttgaagtctgaagttaatggtatggagcatgacctgatgcagagacggctcaga
agagtcagctgcaccactgcgatccctacgcctgaggaaatgacaagattgagaagcatg
aacagacaactccagataaatgttgactgtacactgaaagaagttgacctccttcaatct
agaggaaactttgatccaaaagccatgaataatttttatgacaacatagaacctggccca
gttgtaccacccaagccatctaaaaaagactcctcagacccctgcacaattgagagaaaa
gcccgaagaattagcgtgacctccaaagtacaggcagacatccatgacacccaggcagca
gctgcagatgagcatcgaactggctccacacaaagtcctcggacacaacctcgagatgaa
gactacgaaggggctccatggaattgtgatagctgcacctttcttaaccacccagcacta
aatcgctgtgagcagtgcgagatgccacggtacacctga

DBGET integrated database retrieval system