KEGG   Homo sapiens (human): 23122Help
Entry
23122             CDS       T01001                                 

Gene name
CLASP2
Definition
(RefSeq) cytoplasmic linker associated protein 2
  KO
K16578  CLIP-associating protein 1/2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23122 (CLASP2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    23122 (CLASP2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     23122 (CLASP2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Cytoplasmic linker proteins (CLIPs)
     CLIP-associating proteins
      23122 (CLASP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CLASP_N HEAT HEAT_EZ RTP1_C1 Sec7_N Cnd1 TFCD_C TAN Ipi1_N Adaptin_N ParcG MMS19_C
Motif
Other DBs
NCBI-GeneID: 23122
NCBI-ProteinID: NP_001193973
OMIM: 605853
HGNC: 17078
Ensembl: ENSG00000163539
Vega: OTTHUMG00000156489
Pharos: O75122(Tbio)
UniProt: O75122
Structure
PDB: 

Position
3p22.3
AA seq 1294 aa AA seqDB search
MAMGDDKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEG
GAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLL
VAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVP
TLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLL
QEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEPSY
QKSLQTYLKSSGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGRVSAGSSKASS
LPGSLQRSRSDIDVNAAAGAKAHHAAGQSVRSGRLGAGALNAGSYASLEDTSDKLDGTAS
EDGRVRAKLSAPLAGMGNAKADSRGRSRTKMVSQSQPGSRSGSPGRVLTTTALSTVSSGV
QRVLVNSASAQKRSKIPRSQGCSREASPSRLSVARSSRIPRPSVSQGCSREASRESSRDT
SPVRSFQPLASRHHSRSTGALYAPEVYGASGPGYGISQSSRLSSSVSAMRVLNTGSDVEE
AVADALKKPARRRYESYGMHSDDDANSDASSACSERSYSSRNGSIPTYMRQTEDVAEVLN
RCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKRVFSMFLETLV
DFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFNILMRF
TVDQTQTPSLKVKVAILKYIETLAKQMDPGDFINSSETRLAVSRVITWTTEPKSSDVRKA
AQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSSMGSPLTRPTPR
SPANWSSPLTSPTNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFSFRSQEDMN
EPLKRDSKKDDGDSMCGGPGMSDPRAGGDATDSSQTALDNKASLLHSMPTHSSPRSRDYN
PYNYSDSISPFNKSALKEAMFDDDADQFPDDLSLDHSDLVAELLKELSNHNERVEERKIA
LYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRALALKVLREILRHQPARFKNY
AELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTADYPINLAAIK
MQTKVIERVSKETLNLLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLS
QLTGSKMKLLNLYIKRAQTGSGGADPTTDVSGQS
NT seq 3885 nt NT seq  +upstreamnt  +downstreamnt
atggctatgggagatgataaaagcttcgatgatgaagaatcagtggatggaaataggcca
tcatcagctgcatcagccttcaaggttcctgcacctaaaacatccggaaatcctgccaac
agtgcaaggaagcctggttcagcaggtggccctaaggttggaggtgcttctaaggaagga
ggtgctggagcagttgatgaagatgattttataaaagcttttacagatgtcccttctatt
cagatttattctagtcgagaactcgaagaaacattaaataaaatcagggaaattttgtca
gatgataaacatgactgggatcagcgtgccaatgcactgaagaaaattcgatcactgctt
gttgctggagctgcacagtatgattgcttttttcaacatttacgattgttggatggagca
cttaaactttcagctaaggatcttagatcccaggtggttagagaagcttgtattactgta
gcccacctttcaacagttttgggaaacaagtttgatcatggcgctgaagccattgtacct
acactttttaatctcgtccccaatagtgcaaaagtcatggcaacttctggatgtgcagca
atcagatttatcattcggcatactcatgtacccagacttatacctttaataacaagcaat
tgcacatcaaaatcagttcccgtgaggagacgttcatttgaatttttagatttattgttg
caagagtggcagactcattcattggaaagacatgcagccgtcttggttgaaactattaaa
aagggaattcatgatgctgacgctgaggccagagtggaggcaagaaagacatacatgggt
cttagaaaccactttcctggtgaagctgaaacattatataattcccttgagccatcttat
cagaagagtcttcaaacttacttaaagagttctggcagtgtagcatctcttccacaatca
gacaggtcctcatccagctcacaggaaagtctcaatcgccctttttcttccaaatggtct
acagcaaatccatcaactgtggctggaagagtatcagcaggcagcagcaaagccagttcc
cttccaggaagcctgcagcgttcacgaagtgacattgatgtgaatgctgctgcaggtgcc
aaggcacatcatgctgctggacagtctgtgcgaagcgggcgcttaggtgcaggtgccctg
aatgcaggttcctatgcgtcactagaggatacttctgacaagctggatggaacagcatct
gaagatggccgggtgagagcaaaactttcagcaccacttgctggcatgggaaatgccaag
gcagattctagaggaagaagtcgaacaaaaatggtgtctcaatcacagcctggtagccgg
tctgggtctccaggaagagttctgaccacaacagccctgtccactgtgagctctggtgtt
caaagagtcctggtcaattcagcctcagcacaaaaaagaagcaagataccacggagccag
ggctgtagcagagaggctagtccatctaggctttcagtggcccgaagcagtcgtattcct
cgaccaagtgtgagtcaaggatgcagccgggaagctagtcgggagagcagcagagacaca
agtcctgttcgctcttttcagcccctcgcctccagacaccattccagatcaactggtgcc
ctctacgcccccgaagtgtatggggcctcaggtccaggttatgggatcagccaatcaagt
cgactgtcgtcttctgttagtgccatgcgagtcctgaacacaggttctgatgtggaggag
gcggtggcagatgccttgaaaaaaccagctcgaagaagatatgaatcatatggaatgcat
tcagatgatgacgccaacagcgatgcatctagtgcttgttcagaacgctcctatagttct
cgaaatggtagtattcctacatatatgaggcagacggaagatgtggcagaagtcctcaat
agatgtgctagttccaattggtcagaaaggaaagaaggcctcctaggtctgcagaactta
ttaaaaaatcagagaacactaagtcgagttgaactgaaaagattatgtgaaattttcaca
agaatgtttgctgaccctcatggcaagagagtattcagcatgtttttggagactctagtg
gatttcatacaagtccacaaagatgatcttcaagattggttgtttgtactgctgacacaa
ctactaaaaaaaatgggtgctgatttgcttggatctgttcaggcaaaagttcagaaagcc
cttgatgttacaagagagtcttttccaaatgatcttcagttcaatattctaatgagattt
acagttgatcagacccagacaccaagcttaaaggtgaaggttgctatccttaaatacata
gaaactctggccaaacagatggatccaggagattttataaattccagtgaaactcgccta
gcagtgtctcgggtcatcacttggacaacagaacccaaaagttctgatgttcggaaggca
gcacagtcagtgctgatttcattatttgaactcaataccccagagtttacaatgttatta
ggagctttaccaaaaacttttcaggatggtgctaccaagcttcttcataatcaccttcga
aacactggcaatggaacccagagttccatggggagtcctttgacaagaccaacaccacga
tcaccagctaactggtccagtcctcttacttctcctaccaatacatcacagaatacttta
tctccaagtgcatttgattatgacacagaaaatatgaactctgaagatatttatagctct
cttagaggtgtcactgaagcaatccagaatttcagcttccgtagccaagaagatatgaat
gagccattgaaaagggattctaaaaaagatgatggcgattcaatgtgtggtggtcctggg
atgtctgacccaagagcaggaggtgatgctactgactcaagtcaaacagctcttgataat
aaagcttcattgctccattcaatgcctactcactcctctccacgctctcgagactataat
ccatataactattcagatagcatcagtcccttcaacaagtctgccctcaaggaagccatg
tttgatgatgatgctgaccagtttcctgacgatctttccctagatcattctgacctagtt
gcagagttgttgaaggagctgtctaaccataatgagcgtgtagaagaaagaaaaattgcc
ctctatgaacttatgaaactgacacaggaagaatcttttagtgtttgggatgaacacttc
aaaacaatattgcttttattgcttgaaacgcttggagataaagagcctacaatcagggct
ttggcattaaaggttttaagagaaatcctaaggcatcaaccagcaagatttaaaaactat
gcagaattgactgtcatgaaaacattggaagcacataaagatcctcataaggaggtggtg
agatctgctgaggaagcggcatcagtgttggccacttcaattagtccagagcagtgcatc
aaagtgctttgtcctatcattcaaactgcagactacccaattaatctggctgcaatcaaa
atgcaaacaaaagtgatagagagagtgtccaaggaaaccctaaacctgcttttgccagag
attatgccaggtctaatacagggttatgataattcagagagcagtgttcggaaagcttgt
gtcttctgcctggtggctgttcatgcggtaattggtgatgaactaaaaccacatctcagt
caacttactggcagtaaaatgaagctactgaatctttacatcaaacgtgcacaaacaggt
tctggaggagctgatcccactactgatgtttctggacaaagttag

DBGET integrated database retrieval system