KEGG   Homo sapiens (human): 23125
Entry
23125             CDS       T01001                                 
Symbol
CAMTA2
Name
(RefSeq) calmodulin binding transcription activator 2
  KO
K21596  calmodulin-binding transcription activator
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    23125 (CAMTA2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   Others
    23125 (CAMTA2)
SSDB
Motif
Pfam: CG-1 TIG Ank_5 Ank_2 IQ AGRB_N Ank_4 GlnD_UR_UTase SgrT RhoGEF67_u2
Other DBs
NCBI-GeneID: 23125
NCBI-ProteinID: NP_055914
OMIM: 611508
HGNC: 18807
Ensembl: ENSG00000108509
Pharos: O94983(Tbio)
UniProt: O94983
Position
17:complement(4967997..4987675)
AA seq 1202 aa
MNTKDTTEVAENSHHLKIFLPKKLLECLPRCPLLPPERLRWNTNEEIASYLITFEKHDEW
LSCAPKTRPQNGSIILYNRKKVKYRKDGYLWKKRKDGKTTREDHMKLKVQGMECLYGCYV
HSSIVPTFHRRCYWLLQNPDIVLVHYLNVPALEDCGKGCSPIFCSISSDRREWLKWSREE
LLGQLKPMFHGIKWSCGNGTEEFSVEHLVQQILDTHPTKPAPRTHACLCSGGLGSGSLTH
KCSSTKHRIISPKVEPRALTLTSIPHAHPPEPPPLIAPLPPELPKAHTSPSSSSSSSSSG
FAEPLEIRPSPPTSRGGSSRGGTAILLLTGLEQRAGGLTPTRHLAPQADPRPSMSLAVVV
GTEPSAPPAPPSPAFDPDRFLNSPQRGQTYGGGQGVSPDFPEAEAAHTPCSALEPAAALE
PQAAARGPPPQSVAGGRRGNCFFIQDDDSGEELKGHGAAPPIPSPPPSPPPSPAPLEPSS
RVGRGEALFGGPVGASELEPFSLSSFPDLMGELISDEAPSIPAPTPQLSPALSTITDFSP
EWSYPEGGVKVLITGPWTEAAEHYSCVFDHIAVPASLVQPGVLRCYCPAHEVGLVSLQVA
GREGPLSASVLFEYRARRFLSLPSTQLDWLSLDDNQFRMSILERLEQMEKRMAEIAAAGQ
VPCQGPDAPPVQDEGQGPGFEARVVVLVESMIPRSTWKGPERLAHGSPFRGMSLLHLAAA
QGYARLIETLSQWRSVETGSLDLEQEVDPLNVDHFSCTPLMWACALGHLEAAVLLFRWNR
QALSIPDSLGRLPLSVAHSRGHVRLARCLEELQRQEPSVEPPFALSPPSSSPDTGLSSVS
SPSELSDGTFSVTSAYSSAPDGSPPPAPLPASEMTMEDMAPGQLSSGVPEAPLLLMDYEA
TNSKGPLSSLPALPPASDDGAAPEDADSPQAVDVIPVDMISLAKQIIEATPERIKREDFV
GLPEAGASMRERTGAVGLSETMSWLASYLENVDHFPSSTPPSELPFERGRLAVPSAPSWA
EFLSASTSGKMESDFALLTLSDHEQRELYEAARVIQTAFRKYKGRRLKEQQEVAAAVIQR
CYRKYKQLTWIALKFALYKKMTQAAILIQSKFRSYYEQKRFQQSRRAAVLIQQHYRSYRR
RPGPPHRTSATLPARNKGSFLTKKQDQAARKIMRFLRRCRHRMRELKQNQELEGLPQPGL
AT
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgaataccaaggacaccaccgaggttgctgaaaacagccaccacctgaagatctttctc
cccaagaagctgctggagtgtcttcctcgctgcccgctgctgcctccagagaggctacgg
tggaatacaaatgaggagattgcatcctacctgatcacctttgagaagcatgatgagtgg
ctgtcttgtgccccaaagacaaggcctcagaatggctccatcatcctctacaatcgcaag
aaggtgaaatatcggaaggatggttacctctggaagaagcggaaggatgggaagaccacc
cgagaggaccacatgaagctgaaggtccagggcatggagtgtctctatggctgctacgtt
cactcttccatcgtccccacattccatcggcgctgctactggctgctccagaaccctgac
atcgtccttgtgcactacctgaacgtcccagccctggaggactgtggaaagggctgcagc
cccatcttttgttccatcagcagcgaccgtcgagagtggctgaagtggtcccgggaggag
ttgttgggacagctgaagcccatgtttcatggcatcaagtggagctgcgggaatggaaca
gaagagttctctgtagaacacctggtgcagcagattttggacacccacccaaccaagcct
gctccccgaacccacgcctgtctctgcagtggggggcttggttctgggagccttacccac
aaatgcagcagcacgaaacaccgcatcatctctcccaaagtggagccccgagctttaacc
ctgacctctatcccccacgctcaccccccagagcctcctccactgatagccccacttccc
ccagagctccccaaggcacacacctccccatcttcttcctcttcttcctcctcatcaggt
tttgcagagcccctagaaatcagacctagccctcccacttctcgagggggttcttcaaga
ggaggcactgctatcctcctcctgacaggactggagcagcgggctggaggcttgacgccc
accaggcacttggctccacaggctgatcctaggccttccatgagtttggcagtggttgta
ggcactgagccttctgccccaccagctcctcccagtcctgcctttgaccctgatcgtttt
ctcaacagcccccagaggggccagacatatggaggggggcagggagtaagcccagacttc
cccgaggcagaggccgctcataccccctgttctgccctagagcctgctgctgccctggag
ccccaggcagctgctcggggtcccccaccacagtcagtagcaggtgggagaagaggaaac
tgcttcttcatccaagatgatgacagtggggaggagctcaagggtcacggggctgcccca
cccataccttcaccccctccctcacccccaccctcacctgcccccttggagccgtcaagc
agggtaggaagaggagaggccttgtttggaggacctgttggggccagtgaactggagccc
ttcagtctttcatcattcccagaccttatgggagaactcatcagtgacgaagctccaagc
atccctgctccgaccccccagctgtctcctgctcttagcaccatcacagacttctcccca
gagtggtcctacccagagggtggggtcaaggtgctcatcacaggtccttggaccgaagcc
gccgagcattactcctgtgtctttgatcacatcgcagtgccagcctcacttgtccagcct
ggtgtcttacgctgctactgtcccgcccatgaggtagggctggtgtctttgcaggtggca
gggcgggaggggcccctttctgcttctgtgctctttgagtatcgagcccgccgattcctg
tctctgcctagtactcaacttgactggctgtcactggacgacaaccagttccggatgtcc
atactagagcgactggagcagatggagaagcggatggcagagatcgcagcagctgggcag
gtgccttgccagggtcctgatgctcctccagttcaggatgaaggccaggggcctgggttc
gaagcacgggtagtggtcttggtagaaagcatgatcccacgctccacctggaagggtcct
gaacgtctggcccatggaagccccttccggggcatgagccttctgcacctggctgctgcc
cagggctatgcccgcctcatcgagaccctgagccagtggcggagtgtggagactggaagc
ttggacttagagcaggaggttgacccgctcaacgtggatcatttctcttgcacccctctg
atgtgggcttgtgccctgggacacctggaagctgctgtgctccttttccgttggaaccga
caggcactgagcattcccgactctctgggccgtctgccattgtctgtggctcattcccgg
ggtcatgtgcgccttgcccgctgccttgaggaactacagagacaggagccttcggtggag
cccccatttgccctatcgccaccctcctccagcccagacactggtctgagcagcgtctcc
tcgccctcggagctgtcggatggcaccttttccgtcacgtcagcctattctagtgcccca
gatggcagtcccccccctgcacctctgccagcctctgagatgactatggaggacatggcc
ccaggccagctttcctctggtgtcccagaagcccccctactcctcatggactatgaggct
accaactccaaggggcccctctcctcccttcctgccctcccaccagcttcagatgatggg
gctgctccagaggacgctgacagcccacaggctgtggatgtgatcccggtggacatgatc
tcactagccaagcagatcatcgaagccacaccggagcggattaaacgagaggacttcgtg
gggctgcccgaggctggagcctcaatgcgggagcggacaggggctgtggggctcagtgag
accatgtcctggctggccagctacctggagaatgtggaccatttccccagctcaacccct
cccagcgaactgccctttgagcgaggtcgcctggctgtcccttcagcaccctcctgggca
gagtttctctctgcatccaccagtggcaagatggaaagtgattttgccctgctgacacta
tcagatcacgagcagcgggaactgtatgaggctgcccgagtcatccagacggccttccga
aagtacaagggccggcggctgaaggagcagcaggaggtagcagcagctgtaatccagcgc
tgttaccggaagtacaagcagctgacctggattgcacttaagtttgcactctataagaag
atgacccaggcggccatcctgatccagagcaagttccgaagctactatgaacagaagcga
tttcagcagagccgccgagcggctgtgctcatccagcagcactaccgctcctaccgccgc
aggcccggccctccccaccggacttcggccaccctgcctgcccgcaacaaaggctccttt
ctcaccaagaagcaggaccaggcagcccggaagatcatgagattcctgcggcgctgccga
cacaggatgagggaactgaagcagaaccaggagctggaagggcttccccagccgggactg
gccacatga

DBGET integrated database retrieval system