KEGG   Homo sapiens (human): 23129Help
Entry
23129             CDS       T01001                                 

Gene name
PLXND1, PLEXD1
Definition
(RefSeq) plexin D1
  KO
K06822  plexin D
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    23129 (PLXND1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG PSI TIG_plexin Insulin_TMD SIT TIG_2
Motif
Other DBs
NCBI-GeneID: 23129
NCBI-ProteinID: NP_055918
OMIM: 604282
HGNC: 9107
Ensembl: ENSG00000004399
Vega: OTTHUMG00000159547
Pharos: Q9Y4D7(Tbio)
UniProt: Q9Y4D7
Structure
PDB: 

Position
3q22.1
AA seq 1925 aa AA seqDB search
MAPRAAGGAPLSARAAAASPPPFQTPPRCPVPLLLLLLLGAARAGALEIQRRFPSPTPTN
NFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVPDSPLCHAPQLPQASCEHPRRL
TDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFPSML
NVAANHPNASTVGLVLPPAAGAGGSRLLVGATYTGYGSSFFPRNRSLEDHRFENTPEIAI
RSLDTRGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVSAFLHPSDPPPGAQSYAYLA
LNSEARAGDKESQARSLLARICLPHGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVS
VFPARERLFAVFERPQGSPAARAAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLD
SVVQGTGPACERKLNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLTSVAVASVN
NYTAVFLGTVNGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADSGYLYLMTSHQ
MARVKVAACNVHSTCGDCVGAADAYCGWCALETRCTLQQDCTNSSQQHFWTSASEGPSRC
PAMTVLPSEIDVRQEYPGMILQISGSLPSLSGMEMACDYGNNIRTVARVPGPAFGHQIAY
CNLLPRDQFPPFPPNQDHVTVEMSVRVNGRNIVKANFTIYDCSRTAQVYPHTACTSCLSA
QWPCFWCSQQHSCVSNQSRCEASPNPTSPQDCPRTLLSPLAPVPTGGSQNILVPLANTAF
FQGAALECSFGLEEIFEAVWVNESVVRCDQVVLHTTRKSQVFPLSLQLKGRPARFLDSPE
PMTVMVYNCAMGSPDCSQCLGREDLGHLCMWSDGCRLRGPLQPMAGTCPAPEIRAIEPLS
GPLDGGTLLTIRGRNLGRRLSDVAHGVWIGGVACEPLPDRYTVSEEIVCVTGPAPGPLSG
VVTVNASKEGKSRDRFSYVLPLVHSLEPTMGPKAGGTRITIHGNDLHVGSELQVLVNDTD
PCTELMRTDTSIACTMPEGALPAPVPVCVRFERRGCVHGNLTFWYMQNPVITAISPRRSP
VSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFF
INGRAYADEVAVAEELLDPEEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIH
KEQDSLGLQSHEYRVKIGQVSCDIQIVSDRIIHCSVNESLGAAVGQLPITIQVGNFNQTI
ATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIRE
EIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNS
QGSSQAQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRD
RCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSI
CMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNV
SFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYIL
RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPT
DELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYF
FDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQ
AFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEE
SRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMEDNIYE
CYSEA
NT seq 5778 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcgcgccgcgggcggcgcaccccttagcgcccgggccgccgccgccagcccc
ccgccgttccagacgccgccgcggtgcccggtgccgctgctgttgctgctgctcctgggg
gcggcgcgggccggcgccctggagatccagcgtcggttcccctcgcccacgcccaccaac
aacttcgccctggacggcgcggcggggaccgtgtacctggcggccgtcaaccgcctctat
cagctgtcgggcgccaacctgagcctggaggccgaggcggccgtgggcccggtgcccgac
agcccgctgtgtcacgctccgcagctgccgcaggcctcgtgcgagcacccgcggcgcctc
acggacaactacaacaagatcctgcagctggaccccggccagggcctggtagtcgtgtgc
gggtccatctaccagggcttctgccagctgcggcgccggggcaacatctcggccgtggcc
gtgcgcttcccgcccgccgcgccgcccgccgagcccgtcacggtgttccccagcatgctg
aacgtggcggccaaccacccgaacgcgtccaccgtggggctagttctgcctcccgccgcg
ggcgcggggggcagccgcctgctcgtgggcgccacgtacaccggttacggcagctccttc
ttcccgcgcaaccgcagcctggaggaccaccgcttcgagaacacgcccgagatcgccatc
cgctccctggacacgcgcggcgacctggccaagctcttcaccttcgacctcaacccctcc
gacgacaacatcctcaagatcaagcagggcgccaaggagcagcacaagctgggcttcgtg
agcgccttcctgcacccgtccgacccgccgccgggtgcacagtcctacgcgtacctggcg
ctcaacagcgaggcgcgcgcgggcgacaaggagagccaggcgcggagcctgctggcgcgc
atctgcctgccccacggcgccggcggcgacgccaagaagctcaccgagtcctacatccag
ttgggcttgcagtgcgcgggcggcgcgggccgcggcgacctctacagccgcctggtgtcg
gtcttcccagcccgggagcggctctttgctgtcttcgagcggccccaggggtcccccgcg
gcccgcgctgctccggccgcactctgcgccttccgcttcgccgacgtgcgagccgccatc
cgagctgcgcgcaccgcctgcttcgtggaaccggcgcccgacgtggtggcggtgctcgac
agcgtggtgcagggcacgggaccggcctgcgagcgcaagctcaacatccagctccagcca
gagcagctggactgtggagctgctcacctgcagcacccgctgtccatcctgcagcccctg
aaggccacgcccgtgttccgcgccccgggcctcacctccgtggccgtggccagcgtcaac
aactacacagcggtcttcctgggcacggtcaacgggaggcttctcaagatcaacctgaac
gagagcatgcaggtggtgagcaggcgggtggtgactgtggcctatggggagcccgtgcac
catgtcatgcagtttgacccagcagactccggttacctttacctgatgacgtcccaccag
atggccagggtgaaggtcgccgcctgcaacgtgcactccacctgtggggactgcgtgggt
gcggcggacgcctactgcggctggtgtgccctggagacgcggtgcaccttgcagcaggac
tgcaccaattccagccagcagcatttctggaccagtgccagcgagggccccagccgctgt
cctgccatgaccgtcctgccttccgagatcgatgtgcgccaggagtacccaggcatgatc
ctgcagatctcgggcagcctgcccagcctcagtggcatggagatggcctgtgactatggg
aacaacatccgcactgtggctcgggtcccaggccctgcctttggtcaccagattgcctac
tgcaacctcctgccgagggaccagtttccgcccttcccccccaaccaggaccacgtgact
gttgagatgtctgtgagggtcaatgggcggaacatcgtcaaggccaatttcaccatctac
gactgcagccgcactgcacaagtgtacccccacacagcctgtaccagctgcctgtcggca
cagtggccctgtttctggtgcagccagcagcactcctgtgtttccaaccagtctcggtgc
gaggcctcaccaaaccccacgagccctcaggactgcccccggaccctgctctcacccctg
gcacccgtgcctacgggtggctcccagaacatcctggtgcctctggccaacactgccttt
ttccagggtgcagccctggagtgtagttttgggctggaggagatcttcgaggctgtgtgg
gtgaatgagtctgttgtacgctgtgaccaggtggtgctgcacacgacccggaagagccag
gtgttcccgctcagcctccaactaaaggggcggccagcccgattcctggacagccctgag
cccatgacagtcatggtctataactgtgccatgggcagccccgactgttcccagtgcctg
ggccgcgaagacctgggtcacctgtgcatgtggagtgatggctgccgcctgcgggggcct
ctgcagcccatggctggcacctgccccgcccccgagatccgcgcgattgagcccctgagt
ggcccgttggacggtgggaccctgctgaccatccgaggaaggaacctgggccggcggctc
agtgacgtggcccacggcgtgtggattggtggtgtggcctgtgagccactgcctgacaga
tacacggtgtcggaggagatcgtgtgtgtcacagggccagccccaggaccactctcaggt
gtggtgaccgtgaacgcctctaaggagggcaagtcccgggaccgcttctcctacgtgctg
cccctggtccactccctggagcctaccatgggccccaaggccgggggcaccaggatcacc
atccatgggaatgacctccatgtaggctccgagctccaggtcctggtgaacgacacagac
ccctgcacggagctgatgcgcacagataccagcatcgcctgcaccatgcctgagggggcc
ctgccggctccggtgcctgtgtgtgtgcgcttcgagcgtcggggctgcgtgcacggcaac
ctcaccttctggtacatgcagaacccggtcatcacggccatcagtccccgccgcagccct
gtcagtggcggcaggaccatcacagtggctggtgagcgtttccacatggtgcagaatgtg
tccatggccgtccaccacattggccgggagcccacgctctgcaaggttctcaactccacc
ctcatcacctgcccgtcccccggggccctgagcaacgcatcagcgccagtggacttcttc
atcaatgggcgggcctacgcagacgaggtggctgtggctgaggagctactggaccccgag
gaggcacagcggggcagcaggttccgcctggactacctccccaacccacagttctctacg
gccaagagggagaagtggatcaagcaccaccccggggagcctctcaccctcgttatccac
aaggagcaggacagcctggggctccagagtcacgagtaccgggtcaagataggccaagta
agctgcgacatccagattgtctctgacagaatcatccactgctcggtcaacgagtccctg
ggcgcggccgtggggcagctgcccatcacaatccaggtagggaacttcaaccagaccatc
gccacactgcagctggggggcagcgagacggccatcatcgtgtccatcgtcatctgcagc
gtcctgctgctgctctccgtggtggccctgttcgtcttctgtaccaagagccgacgtgct
gagcgttactggcagaagacgctgctgcagatggaggagatggaatctcagatccgagag
gaaatccgcaaaggcttcgctgagctgcagacagacatgacagatctcaccaaggagctg
aaccgcagccagggcatccccttcctggagtataagcacttcgtgacccgcaccttcttc
cccaagtgttcctccctttatgaagagcgttacgtgctgccctcccagaccctcaactcc
cagggcagctcccaggcacaggaaacccacccactgctgggagagtggaagattcctgag
agctgccggcccaacatggaagagggaattagcttgttctcctcactactcaacaacaag
cacttcctcatcgtctttgtccacgcgctggagcagcagaaggactttgcggtgcgcgac
aggtgcagcctggcctcgctgctgaccatcgcgctgcacggcaagctggagtactacacc
agcatcatgaaggagctgctggtggacctcattgacgcctcggccgccaagaaccccaag
ctcatgctgcggcgcacagagtctgtggtggagaagatgctcaccaactggatgtccatc
tgcatgtacagctgtctgcgggagacggtgggggagccattcttcctgctgctgtgtgcc
atcaagcagcaaatcaacaagggctccatcgacgccatcacaggcaaggcccgctacaca
ctcaatgaggagtggctgctgcgggagaacatcgaggccaagccccggaacctgaacgtg
tccttccagggctgtggcatggactcgctgagcgtgcgggccatggacaccgacacgctg
acacaggtcaaggagaagatcctggaggccttctgcaagaatgtgccctactcccagtgg
ccgcgtgcagaggacgtcgaccttgagtggttcgcctccagcacacagagctacatcctt
cgggacctggacgacacctcagtggtggaagacggccgcaagaagcttaacacgctggcc
cattacaagatccctgaaggtgcctccctggccatgagtctcatagacaagaaggacaac
acactgggccgagtgaaagacttggacacagagaagtatttccatttggtgctgcctacg
gacgagctggcggagcccaagaagtctcaccggcagagccatcgcaagaaggtgctcccg
gaaatctacctgacccgcctgctctccaccaagggcacgttgcagaagtttctggatgac
ctgttcaaggccattctgagtatccgtgaagacaagcccccactggctgtcaagtacttt
ttcgacttcctggaggagcaggctgagaagaggggaatctccgaccccgacaccctacac
atctggaagaccaacagccttcctctccggttctgggtgaacatcctgaagaacccccag
tttgtctttgacatcgacaagacagaccacatcgacgcctgcctttcagtcatcgcgcag
gccttcatcgacgcctgctccatctctgacctgcagctgggcaaggattcgccaaccaac
aagctcctctacgccaaggagattcctgagtaccggaagatcgtgcagcgctactacaag
cagatccaggacatgacgccgctcagcgagcaagagatgaatgcccatctggccgaggag
tcgaggaaataccagaatgagttcaacaccaatgtggccatggcagagatttataagtac
gccaagaggtatcggccgcagatcatggccgcgctggaggccaaccccacggcccggagg
acacaactgcagcacaagtttgagcaggtggtggctttgatggaggacaacatctacgag
tgctacagtgaggcctga

DBGET integrated database retrieval system