KEGG   Homo sapiens (human): 23130
Entry
23130             CDS       T01001                                 

Gene name
ATG2A
Definition
(RefSeq) autophagy related 2A
  KO
K17906  autophagy-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    23130 (ATG2A)
   04136 Autophagy - other
    23130 (ATG2A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    23130 (ATG2A)
   05014 Amyotrophic lateral sclerosis
    23130 (ATG2A)
   05016 Huntington disease
    23130 (ATG2A)
   05017 Spinocerebellar ataxia
    23130 (ATG2A)
   05022 Pathways of neurodegeneration - multiple diseases
    23130 (ATG2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23130 (ATG2A)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    23130 (ATG2A)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    23130 (ATG2A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    23130 (ATG2A)
SSDB
Motif
Pfam: ATG_C Chorein_N ATG2_CAD
Other DBs
NCBI-GeneID: 23130
NCBI-ProteinID: NP_055919
OMIM: 616225
HGNC: 29028
Ensembl: ENSG00000110046
Vega: OTTHUMG00000066831
Pharos: Q2TAZ0(Tdark)
UniProt: Q2TAZ0
Position
11q13.1
AA seq 1938 aa
MSRWLWPWSNCVKERVCRYLLHHYLGHFFQEHLSLDQLSLDLYKGSVALRDIHLEIWSVN
EVLESMESPLELVEGFVGSIEVAVPWAALLTDHCTVRVSGLQLTLQPRRGPAPGAADSQS
WASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMFAQTIETVLRRIKVTFLDTVVRVEH
SPGDGERGVAVEVRVQRLEYCDEAVRDPSQAPPVDVHQPPAFLHKLLQLAGVRLHYEELP
AQEEPPEPPLQIGSCSGYMELMVKLKQNEAFPGPKLEVAGQLGSLHLLLTPRQLQQLQEL
LSAVSLTDHEGLADKLNKSRPLGAEDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLD
NTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDT
MRPDSLLKMTLGGVTLTLLQTSAPSSGPPDLATHFFTEFDATKDGPFGSRDFHHLRPRFQ
RACPCSHVRLTGTAVQLSWELRTGSRGRRTTSMEVHFGQLEVLECLWPRGTSEPEYTEIL
TFPGTLGSQASARPCAHLRHTQILRRVPKSRPRRSVACHCHSELALDLANFQADVELGAL
DRLAALLRLATVPAEPPAGLLTEPLPAMEQQTVFRLSAPRATLRLRFPIADLRPEPDPWA
GQAVRAEQLRLELSEPQFRSELSSGPGPPVPTHLELTCSDLHGIYEDGGKPPVPCLRVSK
ALDPKSTGRKYFLPQVVVTVNPQSSSTQWEVAPEKGEELELSVESPCELREPEPSPFSSK
RTMYETEEMVIPGDPEEMRTFQSRTLALSRCSLEVILPSVHIFLPSKEVYESIYNRINND
LLMWEPADLLPTPDPAAQPSGFPGPSGFWHDSFKMCKSAFKLANCFDLTPDSDSDDEDAH
FFSVGASGGPQAAAPEAPSLHLQSTFSTLVTVLKGRITALCETKDEGGKRLEAVHGELVL
DMEHGTLFSVSQYCGQPGLGYFCLEAEKATLYHRAAVDDYPLPSHLDLPSFAPPAQLAPT
IYPSEEGVTERGASGRKGQGRGPHMLSTAVRIHLDPHKNVKEFLVTLRLHKATLRHYMAL
PEQSWHSQLLEFLDVLDDPVLGYLPPTVITILHTHLFSCSVDYRPLYLPVRVLITAETFT
LSSNIIMDTSTFLLRFILDDSALYLSDKCEVETLDLRRDYVCVLDVDLLELVIKTWKGST
EGKLSQPLFELRCSNNVVHVHSCADSCALLVNLLQYVMSTGDLHPPPRPPSPTEIAGQKL
SESPASLPSCPPVETALINQRDLADALLDTERSLRELAQPSGGHLPQASPISVYLFPGER
SGAPPPSPPVGGPAGSLGSCSEEKEDEREEEGDGDTLDSDEFCILDAPGLGIPPRDGEPV
VTQLHPGPIVVRDGYFSRPIGSTDLLRAPAHFPVPSTRVVLREVSLVWHLYGGRDFGPHP
GHRARTGLSGPRSSPSRCSGPNRPQNSWRTQGGSGRQHHVLMEIQLSKVSFQHEVYPAEP
ATGPAAPSQELEERPLSRQVFIVQELEVRDRLASSQINKFLYLHTSERMPRRAHSNMLTI
KALHVAPTTNLGGPECCLRVSLMPLRLNVDQDALFFLKDFFTSLVAGINPVVPGETSAEA
RPETRAQPSSPLEGQAEGVETTGSQEAPGGGHSPSPPDQQPIYFREFRFTSEVPIWLDYH
GKHVTMDQVGTFAGLLIGLAQLNCSELKLKRLCCRHGLLGVDKVLGYALNEWLQDIRKNQ
LPGLLGGVGPMHSVVQLFQGFRDLLWLPIEQYRKDGRLMRGLQRGAASFGSSTASAALEL
SNRLVQAIQATAETVYDILSPAAPVSRSLQDKRSARRLRRGQQPADLREGVAKAYDTVRE
GILDTAQTICDVASRGHEQKGLTGAVGGVIRQLPPTVVKPLILATEATSSLLGGMRNQIV
PDAHKDHALKWRSDSAQD
NT seq 5817 nt   +upstreamnt  +downstreamnt
atgtcacgatggctgtggccatggtcaaactgtgtgaaagagcgggtctgccgctacttg
ctgcaccactacttaggtcacttcttccaagagcacctcagcctggaccagctcagcctc
gatctgtacaagggcagcgttgccctgcgagacatccacctggaaatctggtctgtgaac
gaggtgctggagtcaatggagtcaccgctggagctggtggaaggcttcgtgggctccatc
gaggtggccgtgccctgggctgctctgctcaccgaccactgcacagtgcgcgtgtccggc
ctccagctcaccttgcagccccgccggggtccagcgccaggggctgccgactcacagagc
tgggcctcatgcatgaccacaagcctgcagctggcccaggagtgtctgcgggatgggcta
ccggagccctctgagccaccacagcccctggaggggctggagatgtttgcccagaccatt
gagactgtgcttcggaggatcaaagtgaccttcctggacactgtcgtgagggtggagcac
tctccgggtgatggggaacgtggtgtggccgtcgaggtccgtgtgcagagactggagtac
tgtgatgaggcagtgcgggacccaagccaggcgccgccggtggacgtgcatcagccgcct
gccttcctgcacaagctgctgcagctggcaggggtccgcctgcactacgaggagctcccg
gcacaggaagagcctccagagccccccttgcagatcggcagctgctcagggtacatggag
ctgatggtgaagttgaagcaaaatgaggccttccctggccccaagttggaggtggcggga
cagctgggctccctgcacctgctcctgaccccgaggcagctccagcaacttcaggaactg
ctcagcgccgtgagccttacagaccacgagggcctggctgacaagctgaacaagagccgc
ccgctaggtgccgaagacctgtggctgattgagcaggacctgaaccagcagctgcaggca
ggggcagtggctgagcccctcagcccagacccccttaccaacccccttctcaacctggat
aacactgacctcttcttctccatggctggcctcacaagcagtgtggcctcagccctctct
gagctctccctctccgatgtagacctggcctcctctgtgcgcagcgacatggcctcccgc
cggctctctgcccaggcccacccagctggcaagatggcccccaaccccctcctggacacc
atgcgccctgactcgctgctgaagatgaccttggggggtgtgaccctgaccttgcttcag
acgtctgccccatcttccggaccacctgacctcgccacgcactttttcaccgagtttgat
gccaccaaggatgggcccttcggttcccgagacttccatcaccttcgaccacgcttccag
agggcctgtccctgtagccatgttcggctaacgggcacagccgtgcagctgtcctgggag
ctgcggacgggcagtcggggccggcggacaaccagcatggaagtgcacttcgggcagctg
gaggtgctggagtgtctgtggccccggggcacctctgagcctgagtacacggagatcctg
acctttcctggtacgctgggctcccaggcctcagctcggccctgcgcccatctgcgccac
acacagatcctgcgccgtgtgcctaagagccgaccccggcgctcagttgcctgccattgc
cactcagaactggccctggacctggccaacttccaggcggacgtggagctgggggccctg
gaccggctggccgccctactgcgcctggccaccgtacctgctgagcctccagccggcctg
ctgacagagcccctgccggcgatggagcagcagacggtatttcggctctctgcaccccgg
gccacgctgcggctgcgcttccccattgccgacctgcggcctgagccggacccctgggcg
ggccaggccgtgcgggctgagcagcttcggctggagctgagtgagccccagttccggtca
gagcttagcagtgggcctggtcccccagtccccacccacctggaactcacctgctccgac
ctacatggtatctatgaagatggagggaagccacctgtcccttgcctgcgtgtctccaaa
gccctggaccccaagagcactgggcgcaagtacttcctgccccaggtagtggtgactgtg
aacccccagtccagcagcacacagtgggaggtggccccggagaagggagaggaactggag
ctgtcagtggagagtccctgtgagctgcgggaacctgagccctcgcccttctcctctaag
aggaccatgtatgagacagaggagatggtgatccctggagaccctgaggagatgaggacg
ttccagagccggaccctggcactgtcccgctgcagcctggaagtgatcctgcccagtgtc
cacatctttctgcccagcaaggaggtctacgagagcatctacaacaggatcaacaacgac
ctgctcatgtgggagcctgcagatctgcttcccacccccgaccccgccgcccagccctcg
ggcttccccggcccctcaggcttctggcacgacagctttaagatgtgcaagtcagccttc
aagctggccaactgctttgatctcaccccagactcggactcggatgacgaggatgcccac
ttcttctcagtgggggcatcaggtggcccacaggccgctgcccctgaggccccaagtctt
cacttgcagagcaccttctctacactggtgacagtgctgaaggggcggatcacagccctc
tgtgagaccaaggatgagggtgggaagcggctggaggctgtgcacggggagctggtgctg
gacatggagcacggtaccctcttcagcgtctcccagtactgtggccagccaggacttggc
tacttctgtctggaagctgaaaaggcaacactctaccaccgagcggccgtggatgactac
ccgctgcccagtcacctggaccttcccagtttcgctcccccggctcagctggccccaacc
atctacccatcggaggaaggggtgaccgagcggggagcctcgggccgcaagggccagggc
cggggaccccacatgttgtccactgctgtgcgcatccacctggacccccacaagaatgtg
aaggagttcctggtgacactgcggttgcacaaagccaccttgcgccactacatggccctg
cccgagcagagctggcattcccagttgttggagttcctagacgtgctggatgaccctgtg
ctgggctacctgcccccgacggtcatcaccatcctgcacacacacctgttctcctgctct
gtggactataggccactctacctcccagtgcgtgtcctcatcaccgcggagaccttcact
ctctccagcaacatcatcatggacacctccaccttcctgctcaggttcatcctcgatgac
tccgccttgtacctgtccgacaagtgtgaggtggagaccctggacctgcggcgagattat
gtctgtgttttggatgttgacctcttggaacttgtgattaaaacctggaaagggagcacc
gagggcaaactgagccagccactattcgagctgcgctgctccaacaatgtggtacacgtg
cacagctgtgccgactcctgtgccctgctggtcaacctgctccagtacgtaatgagcaca
ggcgatctgcaccccccaccccggccccccagccccacggagatcgccggccagaagctc
tcggagagtcctgcctctctgccctcgtgccccccagtggagacggccctcatcaaccag
cgtgacctggccgacgccctcctggacaccgagcgcagcctacgggagctggcccagcct
tcaggtggccacctccctcaggcgtcgcccatctccgtctacctattcccaggtgaacgg
agtggggccccacccccttcaccacctgtcgggggccctgctggcagcttagggtcatgc
tcagaggagaaggaagatgaaagggaagaggagggcgatggagacaccctggacagtgat
gagttctgcatccttgatgctcccggcctgggcatcccgccccgagatggggagcctgtg
gtgacacagctgcatcccggccccatcgttgtgagggacggttacttctcacggccgatc
ggcagcacggacttgctgcgggcacctgcccatttcccagtgcccagcactcgggtggtg
ctacgtgaggtctccctcgtctggcacctctatgggggccgagactttggcccccacccc
ggccacagggcaagaactggcctctcaggtcccaggagctccccttcccgctgctctggc
cccaaccggccccagaactcatggcgcacgcaggggggcagcgggcggcagcaccatgtc
ctcatggagatccagctgagcaaggtaagcttccagcacgaggtgtacccagcggagcca
gccacaggccctgcggcccccagccaggagctggaggagcgaccgctgtcccgtcaggtg
ttcatcgtgcaggagctggaggtccgagaccggctcgcctcctcccagatcaacaagttc
ctgtacctacacacgagtgagcggatgccgcgacgtgcccactctaacatgctcaccatc
aaagcgctgcatgtggcccccactaccaacctgggtgggcctgagtgctgtctccgcgtc
tcgctgatgcccctgcggctcaatgtggaccaggatgccctcttcttcctcaaggacttc
ttcactagtctggtggccggcatcaaccccgtggtcccaggggagacctccgctgaggct
cgccccgagactcgagcccagcccagcagccccctggaagggcaggccgaaggcgtagag
accactggttcgcaggaggccccaggaggtggacacagcccctcccctcctgaccagcag
cccatctacttcagagagttccgcttcacgtctgaggtccccatctggctggattaccat
ggcaagcacgtcacgatggaccaggtgggcacttttgctggcctcctcatcggcctggcc
caactcaactgctccgagctgaagctaaagcggctctgttgcaggcacgggctcctgggt
gtggacaaggtgctgggctatgccctcaacgagtggctgcaggacatccgcaagaaccag
ctgcccggcctgctgggaggcgtgggccccatgcactcggttgtccagctcttccaaggg
ttccgggacctgctgtggctgcccattgagcagtacaggaaggatggccgcctcatgcgg
gggctgcagcgaggggctgcctcctttggctcatccacagcctctgccgccctggaactc
agcaaccggttggtacaggctatccaggccacagctgagaccgtgtatgacatcctgtcc
ccggcagcccccgtctcccgctccctgcaggataagcgctctgcgcggaggctgcgcagg
ggccagcagcctgccgacctgcgggagggtgtggccaaggcctacgacacagtgcgagag
ggcatcttggatacagctcagaccatctgtgacgtggcatcgcggggccatgagcagaag
gggctgacgggcgccgtggggggcgtgatccgccagctgcccccgactgtggtgaagccg
ctcatcctggccacggaggccacgtccagcctgctcgggggcatgcgcaaccagattgtc
cccgacgcccacaaggaccacgccctcaagtggcgctcggacagtgcccaagactga

DBGET integrated database retrieval system