KEGG   Homo sapiens (human): 23130Help
Entry
23130             CDS       T01001                                 

Gene name
ATG2A
Definition
(RefSeq) autophagy related 2A
  KO
K17906  autophagy-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    23130 (ATG2A)
   04136 Autophagy - other
    23130 (ATG2A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    23130 (ATG2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23130 (ATG2A)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    23130 (ATG2A)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    23130 (ATG2A)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    23130 (ATG2A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    23130 (ATG2A)
Transporters [BR:hsa02000]
 Other transporters
  Others
   23130 (ATG2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG_C Chorein_N VPS13_C ATG2_CAD
Motif
Other DBs
NCBI-GeneID: 23130
NCBI-ProteinID: NP_055919
OMIM: 616225
HGNC: 29028
Ensembl: ENSG00000110046
Vega: OTTHUMG00000066831
Pharos: Q2TAZ0(Tdark)
UniProt: Q2TAZ0
Position
11q13.1
AA seq 1938 aa AA seqDB search
MSRWLWPWSNCVKERVCRYLLHHYLGHFFQEHLSLDQLSLDLYKGSVALRDIHLEIWSVN
EVLESMESPLELVEGFVGSIEVAVPWAALLTDHCTVRVSGLQLTLQPRRGPAPGAADSQS
WASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMFAQTIETVLRRIKVTFLDTVVRVEH
SPGDGERGVAVEVRVQRLEYCDEAVRDPSQAPPVDVHQPPAFLHKLLQLAGVRLHYEELP
AQEEPPEPPLQIGSCSGYMELMVKLKQNEAFPGPKLEVAGQLGSLHLLLTPRQLQQLQEL
LSAVSLTDHEGLADKLNKSRPLGAEDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLD
NTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDT
MRPDSLLKMTLGGVTLTLLQTSAPSSGPPDLATHFFTEFDATKDGPFGSRDFHHLRPRFQ
RACPCSHVRLTGTAVQLSWELRTGSRGRRTTSMEVHFGQLEVLECLWPRGTSEPEYTEIL
TFPGTLGSQASARPCAHLRHTQILRRVPKSRPRRSVACHCHSELALDLANFQADVELGAL
DRLAALLRLATVPAEPPAGLLTEPLPAMEQQTVFRLSAPRATLRLRFPIADLRPEPDPWA
GQAVRAEQLRLELSEPQFRSELSSGPGPPVPTHLELTCSDLHGIYEDGGKPPVPCLRVSK
ALDPKSTGRKYFLPQVVVTVNPQSSSTQWEVAPEKGEELELSVESPCELREPEPSPFSSK
RTMYETEEMVIPGDPEEMRTFQSRTLALSRCSLEVILPSVHIFLPSKEVYESIYNRINND
LLMWEPADLLPTPDPAAQPSGFPGPSGFWHDSFKMCKSAFKLANCFDLTPDSDSDDEDAH
FFSVGASGGPQAAAPEAPSLHLQSTFSTLVTVLKGRITALCETKDEGGKRLEAVHGELVL
DMEHGTLFSVSQYCGQPGLGYFCLEAEKATLYHRAAVDDYPLPSHLDLPSFAPPAQLAPT
IYPSEEGVTERGASGRKGQGRGPHMLSTAVRIHLDPHKNVKEFLVTLRLHKATLRHYMAL
PEQSWHSQLLEFLDVLDDPVLGYLPPTVITILHTHLFSCSVDYRPLYLPVRVLITAETFT
LSSNIIMDTSTFLLRFILDDSALYLSDKCEVETLDLRRDYVCVLDVDLLELVIKTWKGST
EGKLSQPLFELRCSNNVVHVHSCADSCALLVNLLQYVMSTGDLHPPPRPPSPTEIAGQKL
SESPASLPSCPPVETALINQRDLADALLDTERSLRELAQPSGGHLPQASPISVYLFPGER
SGAPPPSPPVGGPAGSLGSCSEEKEDEREEEGDGDTLDSDEFCILDAPGLGIPPRDGEPV
VTQLHPGPIVVRDGYFSRPIGSTDLLRAPAHFPVPSTRVVLREVSLVWHLYGGRDFGPHP
GHRARTGLSGPRSSPSRCSGPNRPQNSWRTQGGSGRQHHVLMEIQLSKVSFQHEVYPAEP
ATGPAAPSQELEERPLSRQVFIVQELEVRDRLASSQINKFLYLHTSERMPRRAHSNMLTI
KALHVAPTTNLGGPECCLRVSLMPLRLNVDQDALFFLKDFFTSLVAGINPVVPGETSAEA
RPETRAQPSSPLEGQAEGVETTGSQEAPGGGHSPSPPDQQPIYFREFRFTSEVPIWLDYH
GKHVTMDQVGTFAGLLIGLAQLNCSELKLKRLCCRHGLLGVDKVLGYALNEWLQDIRKNQ
LPGLLGGVGPMHSVVQLFQGFRDLLWLPIEQYRKDGRLMRGLQRGAASFGSSTASAALEL
SNRLVQAIQATAETVYDILSPAAPVSRSLQDKRSARRLRRGQQPADLREGVAKAYDTVRE
GILDTAQTICDVASRGHEQKGLTGAVGGVIRQLPPTVVKPLILATEATSSLLGGMRNQIV
PDAHKDHALKWRSDSAQD
NT seq 5817 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgatggctgtggccatggtcaaactgtgtgaaagagcgggtctgccgctacttg
ctgcaccactacttaggtcacttcttccaagagcacctcagcctggaccagctcagcctc
gatctgtacaagggcagcgttgccctgcgagacatccacctggaaatctggtctgtgaac
gaggtgctggagtcaatggagtcaccgctggagctggtggaaggcttcgtgggctccatc
gaggtggccgtgccctgggctgctctgctcaccgaccactgcacagtgcgcgtgtccggc
ctccagctcaccttgcagccccgccggggtccagcgccaggggctgccgactcacagagc
tgggcctcatgcatgaccacaagcctgcagctggcccaggagtgtctgcgggatgggcta
ccggagccctctgagccaccacagcccctggaggggctggagatgtttgcccagaccatt
gagactgtgcttcggaggatcaaagtgaccttcctggacactgtcgtgagggtggagcac
tctccgggtgatggggaacgtggtgtggccgtcgaggtccgtgtgcagagactggagtac
tgtgatgaggcagtgcgggacccaagccaggcgccgccggtggacgtgcatcagccgcct
gccttcctgcacaagctgctgcagctggcaggggtccgcctgcactacgaggagctcccg
gcacaggaagagcctccagagccccccttgcagatcggcagctgctcagggtacatggag
ctgatggtgaagttgaagcaaaatgaggccttccctggccccaagttggaggtggcggga
cagctgggctccctgcacctgctcctgaccccgaggcagctccagcaacttcaggaactg
ctcagcgccgtgagccttacagaccacgagggcctggctgacaagctgaacaagagccgc
ccgctaggtgccgaagacctgtggctgattgagcaggacctgaaccagcagctgcaggca
ggggcagtggctgagcccctcagcccagacccccttaccaacccccttctcaacctggat
aacactgacctcttcttctccatggctggcctcacaagcagtgtggcctcagccctctct
gagctctccctctccgatgtagacctggcctcctctgtgcgcagcgacatggcctcccgc
cggctctctgcccaggcccacccagctggcaagatggcccccaaccccctcctggacacc
atgcgccctgactcgctgctgaagatgaccttggggggtgtgaccctgaccttgcttcag
acgtctgccccatcttccggaccacctgacctcgccacgcactttttcaccgagtttgat
gccaccaaggatgggcccttcggttcccgagacttccatcaccttcgaccacgcttccag
agggcctgtccctgtagccatgttcggctaacgggcacagccgtgcagctgtcctgggag
ctgcggacgggcagtcggggccggcggacaaccagcatggaagtgcacttcgggcagctg
gaggtgctggagtgtctgtggccccggggcacctctgagcctgagtacacggagatcctg
acctttcctggtacgctgggctcccaggcctcagctcggccctgcgcccatctgcgccac
acacagatcctgcgccgtgtgcctaagagccgaccccggcgctcagttgcctgccattgc
cactcagaactggccctggacctggccaacttccaggcggacgtggagctgggggccctg
gaccggctggccgccctactgcgcctggccaccgtacctgctgagcctccagccggcctg
ctgacagagcccctgccggcgatggagcagcagacggtatttcggctctctgcaccccgg
gccacgctgcggctgcgcttccccattgccgacctgcggcctgagccggacccctgggcg
ggccaggccgtgcgggctgagcagcttcggctggagctgagtgagccccagttccggtca
gagcttagcagtgggcctggtcccccagtccccacccacctggaactcacctgctccgac
ctacatggtatctatgaagatggagggaagccacctgtcccttgcctgcgtgtctccaaa
gccctggaccccaagagcactgggcgcaagtacttcctgccccaggtagtggtgactgtg
aacccccagtccagcagcacacagtgggaggtggccccggagaagggagaggaactggag
ctgtcagtggagagtccctgtgagctgcgggaacctgagccctcgcccttctcctctaag
aggaccatgtatgagacagaggagatggtgatccctggagaccctgaggagatgaggacg
ttccagagccggaccctggcactgtcccgctgcagcctggaagtgatcctgcccagtgtc
cacatctttctgcccagcaaggaggtctacgagagcatctacaacaggatcaacaacgac
ctgctcatgtgggagcctgcagatctgcttcccacccccgaccccgccgcccagccctcg
ggcttccccggcccctcaggcttctggcacgacagctttaagatgtgcaagtcagccttc
aagctggccaactgctttgatctcaccccagactcggactcggatgacgaggatgcccac
ttcttctcagtgggggcatcaggtggcccacaggccgctgcccctgaggccccaagtctt
cacttgcagagcaccttctctacactggtgacagtgctgaaggggcggatcacagccctc
tgtgagaccaaggatgagggtgggaagcggctggaggctgtgcacggggagctggtgctg
gacatggagcacggtaccctcttcagcgtctcccagtactgtggccagccaggacttggc
tacttctgtctggaagctgaaaaggcaacactctaccaccgagcggccgtggatgactac
ccgctgcccagtcacctggaccttcccagtttcgctcccccggctcagctggccccaacc
atctacccatcggaggaaggggtgaccgagcggggagcctcgggccgcaagggccagggc
cggggaccccacatgttgtccactgctgtgcgcatccacctggacccccacaagaatgtg
aaggagttcctggtgacactgcggttgcacaaagccaccttgcgccactacatggccctg
cccgagcagagctggcattcccagttgttggagttcctagacgtgctggatgaccctgtg
ctgggctacctgcccccgacggtcatcaccatcctgcacacacacctgttctcctgctct
gtggactataggccactctacctcccagtgcgtgtcctcatcaccgcggagaccttcact
ctctccagcaacatcatcatggacacctccaccttcctgctcaggttcatcctcgatgac
tccgccttgtacctgtccgacaagtgtgaggtggagaccctggacctgcggcgagattat
gtctgtgttttggatgttgacctcttggaacttgtgattaaaacctggaaagggagcacc
gagggcaaactgagccagccactattcgagctgcgctgctccaacaatgtggtacacgtg
cacagctgtgccgactcctgtgccctgctggtcaacctgctccagtacgtaatgagcaca
ggcgatctgcaccccccaccccggccccccagccccacggagatcgccggccagaagctc
tcggagagtcctgcctctctgccctcgtgccccccagtggagacggccctcatcaaccag
cgtgacctggccgacgccctcctggacaccgagcgcagcctacgggagctggcccagcct
tcaggtggccacctccctcaggcgtcgcccatctccgtctacctattcccaggtgaacgg
agtggggccccacccccttcaccacctgtcgggggccctgctggcagcttagggtcatgc
tcagaggagaaggaagatgaaagggaagaggagggcgatggagacaccctggacagtgat
gagttctgcatccttgatgctcccggcctgggcatcccgccccgagatggggagcctgtg
gtgacacagctgcatcccggccccatcgttgtgagggacggttacttctcacggccgatc
ggcagcacggacttgctgcgggcacctgcccatttcccagtgcccagcactcgggtggtg
ctacgtgaggtctccctcgtctggcacctctatgggggccgagactttggcccccacccc
ggccacagggcaagaactggcctctcaggtcccaggagctccccttcccgctgctctggc
cccaaccggccccagaactcatggcgcacgcaggggggcagcgggcggcagcaccatgtc
ctcatggagatccagctgagcaaggtaagcttccagcacgaggtgtacccagcggagcca
gccacaggccctgcggcccccagccaggagctggaggagcgaccgctgtcccgtcaggtg
ttcatcgtgcaggagctggaggtccgagaccggctcgcctcctcccagatcaacaagttc
ctgtacctacacacgagtgagcggatgccgcgacgtgcccactctaacatgctcaccatc
aaagcgctgcatgtggcccccactaccaacctgggtgggcctgagtgctgtctccgcgtc
tcgctgatgcccctgcggctcaatgtggaccaggatgccctcttcttcctcaaggacttc
ttcactagtctggtggccggcatcaaccccgtggtcccaggggagacctccgctgaggct
cgccccgagactcgagcccagcccagcagccccctggaagggcaggccgaaggcgtagag
accactggttcgcaggaggccccaggaggtggacacagcccctcccctcctgaccagcag
cccatctacttcagagagttccgcttcacgtctgaggtccccatctggctggattaccat
ggcaagcacgtcacgatggaccaggtgggcacttttgctggcctcctcatcggcctggcc
caactcaactgctccgagctgaagctaaagcggctctgttgcaggcacgggctcctgggt
gtggacaaggtgctgggctatgccctcaacgagtggctgcaggacatccgcaagaaccag
ctgcccggcctgctgggaggcgtgggccccatgcactcggttgtccagctcttccaaggg
ttccgggacctgctgtggctgcccattgagcagtacaggaaggatggccgcctcatgcgg
gggctgcagcgaggggctgcctcctttggctcatccacagcctctgccgccctggaactc
agcaaccggttggtacaggctatccaggccacagctgagaccgtgtatgacatcctgtcc
ccggcagcccccgtctcccgctccctgcaggataagcgctctgcgcggaggctgcgcagg
ggccagcagcctgccgacctgcgggagggtgtggccaaggcctacgacacagtgcgagag
ggcatcttggatacagctcagaccatctgtgacgtggcatcgcggggccatgagcagaag
gggctgacgggcgccgtggggggcgtgatccgccagctgcccccgactgtggtgaagccg
ctcatcctggccacggaggccacgtccagcctgctcgggggcatgcgcaaccagattgtc
cccgacgcccacaaggaccacgccctcaagtggcgctcggacagtgcccaagactga

KEGG   Homo sapiens (human): 55102Help
Entry
55102             CDS       T01001                                 

Gene name
ATG2B, C14orf103
Definition
(RefSeq) autophagy related 2B
  KO
K17906  autophagy-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    55102 (ATG2B)
   04136 Autophagy - other
    55102 (ATG2B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    55102 (ATG2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55102 (ATG2B)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    55102 (ATG2B)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55102 (ATG2B)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    55102 (ATG2B)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    55102 (ATG2B)
Transporters [BR:hsa02000]
 Other transporters
  Others
   55102 (ATG2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG_C Chorein_N VPS13_C ATG2_CAD VPS13 FKBP_N
Motif
Other DBs
NCBI-GeneID: 55102
NCBI-ProteinID: NP_060506
OMIM: 616226
HGNC: 20187
Ensembl: ENSG00000066739
Vega: OTTHUMG00000149933
Pharos: Q96BY7(Tbio)
UniProt: Q96BY7
Position
14q32.2
AA seq 2078 aa AA seqDB search
MPWPFSESIKKRACRYLLQRYLGHFLQEKLSLEQLSLDLYQGTGSLAQVPLDKWCLNEIL
ESADAPLEVTEGFIQSISLSVPWGSLLQDNCALEVRGLEMVFRPRPRPATGSEPMYWSSF
MTSSMQLAKECLSQKLTDEQGEGSQPFEGLEKFAETIETVLRRVKVTFIDTVLRIEHVPE
NSKTGTALEIRIERTVYCDETADESSGINVHQPTAFAHKLLQLSGVSLFWDEFSASAKSS
PVCSTAPVETEPKLSPSWNPKIIYEPHPQLTRNLPEIAPSDPVQIGRLIGRLELSLTLKQ
NEVLPGAKLDVDGQIDSIHLLLSPRQVHLLLDMLAAIAGPENSSKIGLANKDRKNRPMQQ
EDEYRIQMELNRYYLRKDSLSVGVSSEQSFYETETARTPSSREEEVFFSMADMDMSHSLS
SLPPLGDPPNMDLELSLTSTYTNTPAGSPLSATVLQPTWGEFLDHHKEQPVRGSTFPSNL
VHPTPLQKTSLPSRSVSVDESRPELIFRLAVGTFSISVLHIDPLSPPETSQNLNPLTPMA
VAFFTCIEKIDPARFSTEDFKSFRAVFAEACSHDHLRFIGTGIKVSYEQRQRSASRYFST
DMSIGQMEFLECLFPTDFHSVPPHYTELLTFHSKEETGSHSPVCLQLHYKHSENRGPQGN
QARLSSVPHKAELQIKLNPVCCELDISIVDRLNSLLQPQKLATVEMMASHMYTSYNKHIS
LHKAFTEVFLDDSHSPANCRISVQVATPALNLSVRFPIPDLRSDQERGPWFKKSLQKEIL
YLAFTDLEFKTEFIGGSTPEQIKLELTFRELIGSFQEEKGDPSIKFFHVSSGVDGDTTSS
DDFDWPRIVLKINPPAMHSILERIAAEEEEENDGHYQEEEEGGAHSLKDVCDLRRPAPSP
FSSRRVMFENEQMVMPGDPVEMTEFQDKAISNSHYVLELTLPNIYVTLPNKSFYEKLYNR
IFNDLLLWEPTAPSPVETFENISYGIGLSVASQLINTFNKDSFSAFKSAVHYDEESGSEE
ETLQYFSTVDPNYRSRRKKKLDSQNKNSQSFLSVLLNINHGLIAVFTDVKQDNGDLLENK
HGEFWLEFNSGSLFCVTKYEGFDDKHYICLHSSSFSLYHKGIVNGVILPTETRLPSSTRP
HWLEPTIYSSEEDGLSKTSSDGVGGDSLNMLSVAVKILSDKSESNTKEFLIAVGLKGATL
QHRMLPSGLSWHEQILYFLNIADEPVLGYNPPTSFTTFHVHLWSCALDYRPLYLPIRSLL
TVETFSVSSSVALDKSSSTLRIILDEAALHLSDKCNTVTINLSRDYVRVMDMGLLELTIT
AVKSDSDGEQTEPRFELHCSSDVVHIRTCSDSCAALMNLIQYIASYGDLQTPNKADMKPG
AFQRRSKVDSSGRSSSRGPVLPEADQQMLRDLMSDAMEEIDMQQGTSSVKPQANGVLDEK
SQIQEPCCSDLFLFPDESGNVSQESGPTYASFSHHFISDAMTGVPTENDDFCILFAPKAA
MQEKEEEPVIKIMVDDAIVIRDNYFSLPVNKTDTSKAPLHFPIPVIRYVVKEVSLVWHLY
GGKDFGIVPPTSPAKSYISPHSSPSHTPTRHGRNTVCGGKGRNHDFLMEIQLSKVKFQHE
VYPPCKPDCDSSLSEHPVSRQVFIVQDLEIRDRLATSQMNKFLYLYCSKEMPRKAHSNML
TVKALHVCPESGRSPQECCLRVSLMPLRLNIDQDALFFLKDFFTSLSAEVELQMTPDPEV
KKSPGADVTCSLPRHLSTSKEPNLVISFSGPKQPSQNDSANSVEVVNGMEEKNFSAEEAS
FRDQPVFFREFRFTSEVPIRLDYHGKHVSMDQGTLAGILIGLAQLNCSELKLKRLSYRHG
LLGVDKLFSYAITEWLNDIKKNQLPGILGGVGPMHSLVQLVQGLKDLVWLPIEQYRKDGR
IVRGFQRGAASFGTSTAMAALELTNRMVQTIQAAAETAYDMVSPGTLSIEPKKTKRFPHH
RLAHQPVDLREGVAKAYSVVKEGITDTAQTIYETAAREHESRGVTGAVGEVLRQIPPAVV
KPLIVATEATSNVLGGMRNQIRPDVRQDESQKWRHGDD
NT seq 6237 nt NT seq  +upstreamnt  +downstreamnt
atgccttggccgttttcggagtccatcaagaagagggcctgccggtacctcctgcagagg
tacctgggccactttctgcaggagaagctgagcctggagcagctcagcctggacctgtac
caaggcaccgggtccctcgcccaggtccccttggacaaatggtgtctcaatgagatcttg
gagtcagcagatgcacccttagaagtcactgaaggattcattcagtcaatttccctgtca
gttccatggggctctttactgcaggataattgtgcactggaagtgagaggattagaaatg
gtcttccggcctagacctcgcccagcaactggttctgagcctatgtattggtcaagtttt
atgaccagcagtatgcaattggcaaaagaatgtcttagccagaaactaacagatgaacaa
ggagaaggatcccagccttttgaaggacttgaaaagtttgctgaaaccattgaaacagta
ctaagaagagtaaaagtcacttttatagatactgttttgagaattgaacatgtgccagaa
aattccaaaactggaactgcacttgaaattcgaatagaaagaactgtgtactgtgatgaa
actgctgacgaatcctcaggaattaatgtgcatcaacccactgcttttgctcacaagtta
cttcagctctctggagtgtctctcttctgggatgagttttctgcatcagccaaatcttcc
ccagtgtgttcaactgcaccagtggaaactgagccaaagctctcacctagctggaacccc
aaaattatttatgagccacacccacagctaactagaaatttaccagagatagcaccttct
gacccagtgcagattggacggttaattggtaggttggagttgagtctcacgttgaaacag
aatgaagtgcttcctggagctaagttggatgttgatggacagatagactctattcatcta
ctcctgtcaccaagacaggtgcacttgcttttggatatgttggcagctattgctggacca
gaaaattctagcaaaatagggttagctaataaagataggaaaaatcgacccatgcagcag
gaagacgagtatcgaattcagatggaattaaaccggtattatttgagaaaagattccctc
tctgtgggtgtatcttcagagcaaagcttttatgagacagaaacagctcgtacaccttct
agccgtgaagaagaagtattcttctccatggctgatatggacatgtctcatagtctctct
tctcttccaccccttggggaccccccaaacatggaccttgagttatcattaactagtaca
tatacaaataccccagcaggatctccattaagtgctactgtgcttcagcccacttgggga
gagttccttgatcatcataaagaacagccagtaagagggtcaacatttccatccaaccta
gttcacccaacacctttacagaagacatctctcccatctagatctgtttcagtggatgaa
tcaaggcctgaacttatttttagactagctgtgggaactttttcaatctctgtgcttcac
attgatcctttatctccacctgaaacgtcacagaaccttaatccattgacacctatggca
gtagctttctttacttgtatagaaaagattgatccagcaagattttcaacagaagatttt
aagtctttccgagcagtgtttgcagaagcttgctcacacgatcaccttagatttataggt
actggcattaaagtatcctatgaacaaagacaaagatcagcttcccgatattttagtact
gatatgtccattgggcaaatggaatttttggagtgcctatttccaactgattttcattct
gttcctcctcactatacagagcttttaacgttccattccaaagaagaaactggttcccat
tcccctgtgtgtcttcagcttcattataagcattctgagaatagagggccccagggtaat
caagcaagacttagttcagttcctcacaaggcagaattgcaaattaaattaaatccagtg
tgttgtgagctggatatcagtattgtggacaggttaaattccttgcttcaaccacagaaa
cttgccacagtagagatgatggcatcccacatgtatacttcatataataaacatattagt
ctgcacaaggctttcactgaagtgtttctagatgattcacatagtcctgcaaattgtcgg
atatcagtacaagttgccacaccagcattaaacctttctgttcgcttcccaatacctgat
cttcgatctgatcaagaaagaggaccatggtttaagaagtcacttcagaaggagatcctt
tatttagccttcacagatctagaatttaagactgaatttataggaggatcaaccccagaa
caaattaaattggaacttacctttagagaactaattggatcgttccaggaagagaaagga
gatccatctattaagtttttccatgtgtctagtggagtagatggagatacaacatcgtca
gatgactttgactggccacgaattgtactgaaaataaatccaccagccatgcattccatt
ttggagagaattgcagctgaagaagaagaggagaatgatggtcactaccaggaggaagag
gaaggaggtgctcattccttgaaagatgtttgtgatctaagaagaccagccccatctcct
ttttcttctcgtagagtaatgtttgaaaatgaacagatggtgatgccaggagaccctgta
gaaatgacagaatttcaggataaagcaatcagcaattctcactatgtgctggaacttacg
ttaccaaatatttatgtaacactacctaataagagcttttatgagaagctttataatagg
atctttaatgacttgctactgtgggaaccaacagctccttcaccagtggagacattcgag
aatatttcctatggcattgggctttcagtagccagtcagctcattaatactttcaacaaa
gatagttttagtgcatttaaatctgcagttcactatgatgaggaaagtggatctgaggag
gagactttgcagtatttttccactgttgatcccaactatcgttctcgcaggaaaaaaaaa
ttagactctcagaacaagaactctcagagttttctctcagttcttctgaatattaatcat
ggattaatagcagtgttcacagatgtgaagcaagataatggagatctgttggaaaacaag
catggtgaattctggttagagttcaatagtggttcattattttgtgtgacaaaatatgaa
ggttttgatgacaagcactacatttgccttcattctagcagtttcagtctgtaccataaa
ggcatagtgaatggagtgattctcccgacagaaacacgacttcccagctcaacccgccca
cactggttggaacctactatttattcctctgaagaagatggcctcagtaaaacttcttca
gatggagttggaggagacagtttgaatatgctgtctgttgccgttaaaatattgtctgat
aaatcagagtccaatacaaaggaatttctcattgccgtaggactgaaaggagccactctc
cagcatagaatgcttccttctgggcttagctggcatgagcagattttatacttcttgaat
attgctgatgaacctgttttgggatataatcctccaacttcatttacaacttttcatgtt
catctttggagctgtgcacttgattatagacccctttatttgccaatccgatctcttctt
accgtggaaacattcagtgtttccagtagcgttgcattggataaatcttcctctactctc
agaataatcttggatgaagctgctttacatctatctgacaaatgcaatactgtcactata
aatctgagtagagattatgttcgtgtgatggatatggggcttttggagttaaccataact
gcagtgaagtctgattctgatggagagcaaactgagccccgctttgagttacactgttcc
agcgatgttgtccatatcagaacgtgctcagactcttgtgctgcgttaatgaatctcatt
cagtacattgcaagctatggtgacttgcagacacctaacaaggcagatatgaagcctgga
gcctttcaaagaaggtctaaggtagattccagtggtcgatcatcctcacgtggtccagta
cttcctgaagcagatcaacaaatgttacgagatctgatgagtgatgctatggaggagatc
gacatgcaacaaggcacctcgtcagtaaaaccacaggctaatggtgttttggatgaaaaa
tctcaaattcaggagccatgttgttcagacctcttcctgtttcctgacgagagtgggaat
gtatcccaggagtccggccccacctatgcctcattctctcaccatttcatcagtgatgca
atgacaggtgtgcccactgagaatgatgacttttgcattctttttgcaccaaaagcagcc
atgcaggagaaggaagaagaaccagttataaaaatcatggttgatgatgcaattgtgata
agagacaattatttcagtctgcccgttaataagaccgatacgagcaaagcccccttacac
tttcccattcctgtgattcgctatgtggtgaaggaggtctctcttgtctggcatctttat
ggaggaaaggattttggaatagtccctcccacttctccggctaaaagttatattagtccc
cacagttcgccttctcacacacccacgagacatggacgtaatacagtatgtgggggaaaa
ggaaggaaccatgactttttaatggaaatacagctaagcaaggtgaagtttcagcatgaa
gtctacccgccatgcaaacctgattgtgattccagcctctcagaacacccagtctcccgg
caggtgttcattgttcaggatcttgagattcgagatcgtttggcaacatcacaaatgaat
aaatttttatacctgtattgcagtaaagaaatgcctcgaaaagctcactccaacatgttg
acagtgaaagccttacacgtgtgtccagaatctggcaggtccccacaggagtgctgcttg
agagtgtcgctgatgccgctccgcctcaatattgaccaggatgctttgttcttcctgaag
gatttcttcacaagtctttctgcagaagtagagcttcaaatgactccagatccagaagtt
aaaaagtctcctggagctgatgtcacctgcagtttgccaaggcatttgagtacctcaaag
gagccaaatctggttatttctttctctgggccaaaacagccttcccaaaatgatagtgcc
aattcagtggaagtggttaatggcatggaagagaagaacttctctgctgaagaagcatct
tttagggatcagcctgtgttttttagagaatttagattcacgtcagaagttcccattcga
cttgattatcatggcaaacatgtatcaatggatcagggtacgctagctgggattttgatt
ggtctggctcagttaaactgctctgaactaaagctcaagaggctttcctatcgacatggt
ttactaggcgttgacaaattattctcatatgcaatcactgagtggcttaatgacattaag
aagaaccagctaccaggaatcctgggaggtgttggacctatgcattcactagtacaatta
gtacaaggcctaaaggacttggtctggctcccaatagagcagtaccggaaggatggccgc
attgtcagagggtttcagagaggcgctgcttcctttggtacctcgacagcgatggctgct
ctagaactcacaaacagaatggttcaaaccatacaggcagctgcagagactgcttatgat
atggtgtctcctggtaccctttctatcgagcccaagaagaccaaaaggtttcctcatcac
cggttagcccaccagccagtagacctgagggaaggtgtggccaaggcctacagtgttgtg
aaagagggaatcacagacacggctcagaccatttatgaaactgcggctcgagaacacgag
agcagaggggtgactggtgccgtgggcgaggttctgcgccagattcctccggcagtggtg
aaacctctgattgttgccacagaagcaacgtcaaacgtgctgggtggcatgagaaaccaa
attaggccagatgtccggcaagacgagtcacagaaatggcgccacggggatgactga

DBGET integrated database retrieval system