KEGG   Homo sapiens (human): 23137Help
Entry
23137             CDS       T01001                                 

Gene name
SMC5, SMC5L1
Definition
(RefSeq) structural maintenance of chromosomes 5
  KO
K22803  structural maintenance of chromosomes protein 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    23137 (SMC5)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     23137 (SMC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SMC_N AAA_23 AAA_21 YqjK AAA_25 AAA_29 Vac_Fusion
Motif
Other DBs
NCBI-GeneID: 23137
NCBI-ProteinID: NP_055925
OMIM: 609386
HGNC: 20465
Ensembl: ENSG00000198887
Vega: OTTHUMG00000019992
Pharos: Q8IY18(Tbio)
UniProt: Q8IY18
Position
9q21.12
AA seq 1101 aa AA seqDB search
MATPSKKTSTPSPQPSKRALPRDPSSEVPSKRKNSAPQLPLLQSSGPFVEGSIVRISMEN
FLTYDICEVSPGPHLNMIVGANGTGKSSIVCAICLGLAGKPAFMGRADKVGFFVKRGCSR
GMVEIELFRASGNLVITREIDVAKNQSFWFINKKSTTQKIVEEKVAALNIQVGNLCQFLP
QDKVGEFAKLSKIELLEATEKSIGPPEMHKYHCELKNLREKEKQLETSCKEKTEYLQKMV
QRNERYKQDVERFYERKRHLDLIEMLEAKRPWVEYENVRQEYEEVKLVRDRVKEEVRKLK
EGQIPVTCRIEEMENERHNLEARIKEKATDIKEASQKCKQKQDVIERKDKHIEELQQALI
VKQNEELDRQRRIGNTRKMIEDLQNELKTTENCENLQPQIDAITNDLRRIQDEKALCEGE
IIDKRRERETLEKEKKSVDDHIVRFDNLMNQKEDKLRQRFRDTYDAVLWLRNNRDKFKQR
VCEPIMLTINMKDNKNAKYIENHIPSNDLRAFVFESQEDMEVFLKEVRDNKKLRVNAVIA
PKSSYADKAPSRSLNELKQYGFFSYLRELFDAPDPVMSYLCCQYHIHEVPVGTEKTRERI
ERVIQETRLKQIYTAEEKYVVKTSFYSNKVISSNTSLKVAQFLTVTVDLEQRRHLEEQLK
EIHRKLQAVDSGLIALRETSKHLEHKDNELRQKKKELLERKTKKRQLEQKISSKLGSLKL
MEQDTCNLEEEERKASTKIKEINVQKAKLVTELTNLIKICTSLHIQKVDLILQNTTVISE
KNKLESDYMAASSQLRLTEQHFIELDENRQRLLQKCKELMKRARQVCNLGAEQTLPQEYQ
TQVPTIPNGHNSSLPMVFQDLPNTLDEIDALLTEERSRASCFTGLNPTIVQEYTKREEEI
EQLTEELKGKKVELDQYRENISQVKERWLNPLKELVEKINEKFSNFFSSMQCAGEVDLHT
ENEEDYDKYGIRIRVKFRSSTQLHELTPHHQSGGERSVSTMLYLMALQELNRCPFRVVDE
INQGMDPINERRVFEMVVNTACKENTSQYFFITPKLLQNLPYSEKMTVLFVYNGPHMLEP
NTWNLKAFQRRRRRITFTQPS
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atggcgactccgagcaagaagacgtcaactccaagcccccagccttccaagagagctctc
ccgagagacccttcgtcggaggtcccgagcaagaggaagaattcggccccgcagctgccg
ctgttgcagtcgtccgggcctttcgtggaaggctctatcgtccgcatctcgatggagaac
ttcctaacatatgatatttgtgaagtatctcctggaccccacttgaatatgatcgttgga
gccaatggaacagggaagtcgagcattgtgtgtgccatttgccttggtttagctggaaaa
cctgctttcatgggacgagcagataaggttgggttttttgtgaagagaggatgttctaga
ggcatggttgaaattgaattgttcagggcttctggaaatcttgtaatcacccgtgagatt
gatgtggcaaaaaatcagtccttttggttcatcaacaaaaaatctacaacccagaaaata
gtggaagagaaagttgcagccttaaatattcaagtggggaatctttgccagtttctccct
caggacaaagttggagaatttgctaaactcagcaaaattgaactcctcgaagccactgaa
aagtcaattggtcccccagaaatgcacaaatatcactgtgaactcaaaaacttaagggag
aaagaaaaacagctcgagacctcatgcaaagagaaaactgagtatctacagaaaatggtt
cagaggaatgaaagatataaacaagatgtggagaggttctatgaacggaagcgacattta
gatttaattgagatgcttgaagcaaaaaggccatgggtggaatatgaaaatgttcgtcag
gaatatgaagaagtaaaactagttcgtgaccgagtgaaggaagaggtcagaaaacttaaa
gaagggcagattcctgtaacatgtcgaattgaagaaatggaaaacgagcgtcacaatttg
gaggctcgaatcaaagaaaaggcaacagatattaaggaggcatctcaaaaatgcaaacag
aagcaagatgttatagaaaggaaagataaacatattgaggaacttcagcaggctttaata
gtaaagcaaaatgaagagcttgaccgacagaggagaataggtaatacccgcaaaatgata
gaggatttgcaaaatgaactaaagaccacggaaaactgcgagaatcttcagccccagatt
gatgccattacaaatgatctgagacggattcaggatgaaaaggcattatgtgaaggcgaa
ataattgataagcgaagagagagggaaactctagagaaggagaaaaagagtgtggacgat
catattgtacgttttgacaatcttatgaatcagaaggaagataagctaagacagagattc
cgtgacacgtatgatgctgttttatggctaagaaataacagagacaaatttaaacaaaga
gtctgtgagcccataatgctcacgatcaatatgaaagataataaaaatgccaaatatatt
gaaaatcatattccatcaaatgacttaagagcctttgtatttgaaagtcaagaagatatg
gaggttttcctcaaagaggttcgtgacaataaaaaattaagagtaaatgctgttattgct
cccaagagttcatatgcagacaaagcaccttcaagatctttgaatgaacttaaacaatac
ggatttttctcttatttgagagaattatttgatgcacctgatcctgtaatgagttacctt
tgctgtcagtatcatattcatgaagttcctgtaggaactgaaaagaccagagaaagaatt
gaacgggtaatacaagaaacccgattaaaacagatttatacagcagaagaaaagtatgtg
gtgaaaacttctttttattcaaacaaagttatttctagtaacacatctctaaaagtagcg
cagtttctcactgtcactgtggacctagagcagagaagacacttagaagaacagctaaag
gaaattcatagaaaattgcaagcagtggattcagggttgattgccttacgtgaaacaagc
aaacatctggagcacaaagacaatgaacttagacaaaagaagaaggagcttcttgagaga
aaaaccaagaaaagacaactggaacaaaaaatcagttccaaactaggaagtttaaagctg
atggaacaggatacttgcaatcttgaagaggaagagcgaaaagcaagtaccaaaatcaaa
gaaataaatgttcaaaaagcgaaacttgttaccgaattaacaaacctaataaagatttgt
acttctttgcatatacaaaaagtagatttaattctccaaaatactacagtgatctctgag
aagaacaaattagaatcagattatatggccgcatcttcacaactccgtcttacagagcaa
catttcattgaattggatgaaaatagacagagattattgcagaaatgcaaggaacttatg
aaaagagctaggcaagtatgtaacctgggtgcagagcagactcttcctcaagaataccag
acacaagtacccaccattccaaatggacacaactcctcactccccatggttttccaagac
cttccaaacacattggatgaaattgatgctttattaactgaagaaagatcaagagcttcc
tgcttcacgggactgaatcctacaattgttcaggaatatacaaaaagagaagaagaaata
gaacagttaactgaggaactaaagggaaagaaagttgaactagatcaatacagggaaaac
atttcacaggtaaaagaaaggtggcttaatcctttaaaagagctggtagaaaaaattaat
gaaaaattcagcaatttttttagttccatgcagtgtgctggtgaagttgatctccataca
gaaaatgaggaagattatgataaatatggaattcgaattagagtcaaatttcgaagtagt
actcaactgcatgaattaactcctcatcatcaaagtggaggtgaaagaagtgtttctacc
atgttatacttgatggcacttcaggagctaaatagatgtccattcagagtagttgatgaa
atcaatcagggaatggacccaatcaatgaacggagagtgtttgaaatggttgtaaatact
gcctgtaaagaaaatacatctcaatactttttcataacaccaaagctcctgcaaaatctt
ccttattctgaaaagatgacagttttgtttgtctacaatggccctcatatgctggaacca
aacacatggaatttaaaggctttccaaaggcggcggcgccgtattacattcactcaacct
tcttaa

DBGET integrated database retrieval system