KEGG   Homo sapiens (human): 23138
Entry
23138             CDS       T01001                                 
Symbol
N4BP3, LZTS4
Name
(RefSeq) NEDD4 binding protein 3
  KO
K26473  NEDD4-binding protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    23138 (N4BP3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   HECT type E3 associated proteins
    23138 (N4BP3)
SSDB
Motif
Pfam: Fez1
Other DBs
NCBI-GeneID: 23138
NCBI-ProteinID: NP_055926
OMIM: 619140
HGNC: 29852
Ensembl: ENSG00000145911
UniProt: O15049
Position
5:178113532..178127034
AA seq 544 aa
MATAPGPAGIAMGSVGSLLERQDFSPEELRAALAGSRGSRQPDGLLRKGLGQREFLSYLH
LPKKDSKSTKNTKRAPRNEPADYATLYYREHSRAGDFSKTSLPERGRFDKCRIRPSVFKP
TAGNGKGFLSMQSLASHKGQKLWRSNGSLHTLACHPPLSPGPRASQARAQLLHALSLDEG
GPEPEPSLSDSSSGGSFGRSPGTGPSPFSSSLGHLNHLGGSLDRASQGPKEAGPPAVLSC
LPEPPPPYEFSCSSAEEMGAVLPETCEELKRGLGDEDGSNPFTQVLEERQRLWLAELKRL
YVERLHEVTQKAERSERNLQLQLFMAQQEQRRLRKELRAQQGLAPEPRAPGTLPEADPSA
RPEEEARWEVCQKTAEISLLKQQLREAQAELAQKLAEIFSLKTQLRGSRAQAQAQDAELV
RLREAVRSLQEQAPREEAPGSCETDDCKSRGLLGEAGGSEARDSAEQLRAELLQERLRGQ
EQALRFEQERRTWQEEKERVLRYQREIQGGYMDMYRRNQALEQELRALREPPTPWSPRLE
SSKI
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggccacagccccaggccctgctggcattgccatgggcagcgtgggcagcctgttggaa
cggcaggacttctcccctgaagagctgcgggcggcacttgccgggtctcggggctcccgc
cagcctgatgggctcctccggaagggcttgggccagcgtgagttcctcagctacctgcac
ctccccaagaaggacagcaagagcaccaagaacaccaagcgggcccctcggaacgagcct
gccgactatgccaccctctactaccgggaacattctcgcgcgggtgacttcagcaagacc
tcgctgccagaacggggtcgctttgacaagtgccgcattcgcccctcagtgttcaagcct
acggcgggcaacgggaaaggcttcctatccatgcaaagtctggcgtcccacaaaggccag
aagctgtggcgcagcaatggcagcctgcacacgctggcctgccacccgcccctgagcccc
gggccccgggccagccaggcccgggcacagctgctgcacgccctcagcctagatgagggc
ggccctgagcccgagcccagcctgtccgactcctccagtgggggtagttttggtcgcagt
cctggtactggccctagccccttcagctcctcccttggccaccttaaccacctcgggggc
tccctggaccgggcctctcaaggacccaaggaggctgggccaccagctgtgctgagctgc
ctgcccgagccaccacccccctacgagttctcctgctcctctgccgaggaaatgggagcc
gtgctgcccgagacctgtgaggagctcaagaggggccttggcgatgaggacggctccaac
cccttcacgcaggtgctggaggagcgccagcggctgtggctggctgagctgaagcgcctg
tatgtggagcggctgcacgaggtgacccagaaggctgagcgcagcgagcgcaacctccag
ctgcagctgtttatggctcagcaggagcagcggcgcctgcgcaaggagctgcgggctcag
cagggcctggctccggagcctcgggcccccggcaccctcccagaggctgaccccagtgca
cgaccagaggaggaagcccgatgggaggtgtgccagaagacagcagagattagcctcttg
aagcagcagctgcgtgaagcccaggcggaactggcccagaagctggcggagatcttcagt
ctgaagacacaacttcggggcagccgggcacaagcccaggctcaggacgcagagctggtc
cggctgcgcgaggctgtgcgcagcctgcaggagcaggcccctcgggaggaagccccaggc
agctgtgagactgatgactgcaagagcaggggcctgctaggggaggcaggaggcagcgag
gccagagacagtgctgagcagctgcgggctgagctgctgcaggagcgacttcggggccag
gagcaggcgctgcgctttgagcaggagcggcggacttggcaggaggagaaggagcgcgtg
ctgcgctaccagcgggagatccagggagggtacatggacatgtaccgccgcaaccaggca
ctggagcaggaactgcgggcactgcgggagccccccacaccctggagtccccggctcgag
tcctccaagatctga

DBGET integrated database retrieval system