KEGG   Homo sapiens (human): 23139Help
Entry
23139             CDS       T01001                                 

Gene name
MAST2, MAST205, MTSSK
Definition
(RefSeq) microtubule associated serine/threonine kinase 2
  KO
K08789  microtubule-associated serine/threonine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    23139 (MAST2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23139 (MAST2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  MAST family [OT]
   23139 (MAST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1908 Pkinase Pkinase_Tyr PDZ_6 PDZ PDZ_2 APH Kinase-like Haspin_kinase Pkinase_fungal Tricorn_PDZ RIO1
Motif
Other DBs
NCBI-GeneID: 23139
NCBI-ProteinID: NP_055927
OMIM: 612257
HGNC: 19035
Ensembl: ENSG00000086015
Vega: OTTHUMG00000008007
Pharos: Q6P0Q8(Tbio)
UniProt: Q6P0Q8
Structure
PDB: 

Position
1p34.1
AA seq 1798 aa AA seqDB search
MKRSRCRDRPQPPPPDRREDGVQRAAELSQSLPPRRRAPPGRQRLEERTGPAGPEGKEQD
VVTGVSPLLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVH
SSVGQVTWQSSGEASNLVRMRNQSLGQSAPSLTAGLKELSLPRRGSFCRTSNRKSLIVTS
STSPTLPRPHSPLHGHTGNSPLDSPRNFSPNAPAHFSFVPARRTDGRRWSLASLPSSGYG
TNTPSSTVSSSCSSQEKLHQLPFQPTADELHFLTKHFSTESVPDEEGRQSPAMRPRSRSL
SPGRSPVSFDSEIIMMNHVYKERFPKATAQMEERLAEFISSNTPDSVLPLADGALSFIHH
QVIEMARDCLDKSRSGLITSQYFYELQDNLEKLLQDAHERSESSEVAFVMQLVKKLMIII
ARPARLLECLEFDPEEFYHLLEAAEGHAKEGQGIKCDIPRYIVSQLGLTRDPLEEMAQLS
SCDSPDTPETDDSIEGHGASLPSKKTPSEEDFETIKLISNGAYGAVFLVRHKSTRQRFAM
KKINKQNLILRNQIQQAFVERDILTFAENPFVVSMFCSFDTKRHLCMVMEYVEGGDCATL
LKNIGALPVDMVRLYFAETVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKIG
LMSLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLV
GCVPFFGDTPEELFGQVISDEIVWPEGDEALPPDAQDLTSKLLHQNPLERLGTGSAYEVK
QHPFFTGLDWTGLLRQKAEFIPQLESEDDTSYFDTRSERYHHMDSEDEEEVSEDGCLEIR
QFSSCSPRFNKVYSSMERLSLLEERRTPPPTKRSLSEEKEDHSDGLAGLKGRDRSWVIGS
PEILRKRLSVSESSHTESDSSPPMTVRRRCSGLLDAPRFPEGPEEASSTLRRQPQEGIWV
LTPPSGEGVSGPVTEHSGEQRPKLDEEAVGRSSGSSPAMETRGRGTSQLAEGATAKAISD
LAVRRARHRLLSGDSTEKRTARPVNKVIKSASATALSLLIPSEHHTCSPLASPMSPHSQS
SNPSSRDSSPSRDFLPALGSMRPPIIIHRAGKKYGFTLRAIRVYMGDSDVYTVHHMVWHV
EDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELILKSGNKVAISTTPLENTSIKVGP
ARKGSYKAKMARRSKRSRGKDGQESRKRSSLFRKITKQASLLHTSRSLSSLNRSLSSGES
GPGSPTHSHSLSPRSPTQGYRVTPDAVHSVGGNSSQSSSPSSSVPSSPAGSGHTRPSSLH
GLAPKLQRQYRSPRRKSAGSIPLSPLAHTPSPPPPTASPQRSPSPLSGHVAQAFPTKLHL
SPPLGRQLSRPKSAEPPRSPLLKRVQSAEKLAAALAASEKKLATSRKHSLDLPHSELKKE
LPPREVSPLEVVGARSVLSGKGALPGKGVLQPAPSRALGTLRQDRAERRESLQKQEAIRE
VDSSEDDTEEGPENSQGAQELSLAPHPEVSQSVAPKGAGESGEEDPFPSRDPRSLGPMVP
SLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSGATDPIPPEGCWKAQ
HLHTQALTALSPSTSGLTPTSSCSPPSSTSGKLSMWSWKSLIEGPDRASPSRKATMAGGL
ANLQDLENTTPAQPKNLSPREQGKTQPPSAPRLAHPSYEDPSQGWLWESECAQAVKEDPA
LSITQVPDASGDRRQDVPCRGCPLTQKSEPSLRRGQEPGGHQKHRDLALVPDELLKQT
NT seq 5397 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggagccgctgccgcgaccgaccgcagccgccgccgcccgaccgccgggaggat
ggagttcagcgggcagcggagctgtctcagtctttgccgccgcgccggcgagcgccgccc
gggaggcagcggctggaggagcggacgggccccgcggggcccgagggcaaggagcaggat
gtagtaactggagttagtcccctgctcttcaggaaactcagtaatcctgacatattttca
tccactggaaaagttaaacttcagcgacaactgagtcaggatgattgtaagttatggaga
ggaaacctggccagctctctatcgggtaagcagctgctccctttgtccagcagtgtacat
agcagtgtgggacaggtgacttggcagtcgtcaggagaagcatcaaacctggttcgaatg
agaaaccagtcccttggacagtctgcaccttctcttactgctggcctgaaggagttgagc
cttccaagaagaggcagcttttgtcggacaagtaaccgcaagagcttgattgtgacctct
agcacatcacctacactaccacggccacactcaccactccatggccacacaggtaacagt
cctttggacagcccccggaatttctctccaaatgcacctgctcacttttcttttgttcct
gcccgtaggactgatgggcggcgctggtctttggcctctttgccctcttcaggatatgga
actaacactcctagctccactgtctcatcatcatgctcctcacaggaaaagctgcatcag
ttgcctttccagcctacagctgatgagctgcactttttgacgaagcatttcagcacagag
agcgtaccagatgaggaaggacggcagtccccagccatgcggcctcgctcccggagcctc
agtcccggacgatccccagtatcctttgacagtgaaataataatgatgaatcatgtttac
aaagaaagattcccaaaggccaccgcacaaatggaagagcgactagcagagtttatttcc
tccaacactccagacagcgtgctgcccttggcagatggagccctgagctttattcatcat
caggtgattgagatggcccgagactgcctggataaatctcggagtggcctcattacatca
caatacttctacgaacttcaagataatttggagaaacttttacaagatgctcatgagcgc
tcagagagctcagaagtggcttttgtgatgcagctggtgaaaaagctgatgattatcatt
gcccgcccagcacgtctcctggaatgcctggagtttgaccctgaagagttctaccacctt
ttagaagcagctgagggccacgccaaagagggacaagggattaaatgtgacattccccgc
tacatcgttagccagctgggcctcacccgggatcccctagaagaaatggcccagttgagc
agctgtgacagtcctgacactccagagacagatgattctattgagggccatggggcatct
ctgccatctaaaaagacaccctctgaagaggacttcgagaccattaagctcatcagcaat
ggcgcctatggggctgtatttctggtgcggcacaagtccacccggcagcgctttgccatg
aagaagatcaacaagcagaacctgatcctacggaaccagatccagcaggccttcgtggag
cgtgacatactgactttcgctgagaacccctttgtggtcagcatgttctgctcctttgat
accaagcgccacttgtgcatggtgatggagtacgttgaagggggagactgtgccactctg
ctgaagaatattggggccctgcctgtggacatggtgcgtctatactttgcggaaactgtg
ctggccctggagtacttacacaactatggcatcgtgcaccgtgacctcaagcctgacaac
ctcctaattacatccatggggcacatcaagctcacggactttggactgtccaaaattggc
ctcatgagtctgacaacgaacttgtatgagggtcatattgaaaaggatgcccgggaattc
ctggacaagcaggtatgcgggaccccagaatacattgcgcctgaggtgatcctgcgccag
ggctatgggaagccagtggactggtgggccatgggcattatcctgtatgagttcctggtg
ggctgcgtccctttttttggagatactccggaggagctctttgggcaggtgatcagtgat
gagattgtgtggcctgagggtgatgaggcactgcccccagacgcccaggacctcacctcc
aaactgctccaccagaaccctctggagagacttggcacaggcagtgcctatgaggtgaag
cagcacccattctttactggtctggactggacaggacttctccgccagaaggctgaattt
attcctcagttggagtcagaggatgatactagctattttgacacccgctcagagcgatac
caccacatggactcggaggatgaggaagaagtgagtgaggatggctgccttgagatccgc
cagttctcttcctgctctccaaggttcaacaaggtgtacagcagcatggagcggctctca
ctgctcgaggagcgccggacaccacccccgaccaagcgcagcctgagtgaggagaaggag
gaccattcagatggcctggcagggctcaaaggccgagaccggagctgggtgattggctcc
cctgagatattacggaagcggctgtcggtgtctgagtcatcccacacagagagtgactca
agccctccaatgacagtgcgacgccgctgctcaggcctcctggatgcgcctcggttcccg
gagggccctgaggaggccagcagcaccctcaggaggcaaccacaggagggtatatgggtc
ctgacacccccatctggagagggggtatctgggcctgtcactgaacactcaggggagcag
cggccaaagctggatgaggaagctgttggccggagcagtggttccagtccagctatggag
acccgaggccgtgggacctcacagctggctgagggagccacagccaaggccatcagtgac
ctggctgtgcgtagggcccgccaccggctgctctctggggactcaacagagaagcgcact
gctcgccctgtcaacaaagtgatcaagtccgcctcagccacagccctctcactcctcatt
ccttcggaacaccacacctgctccccgttggccagccccatgtccccacattctcagtcg
tccaacccatcatcccgggactcttctccaagcagggacttcttgccagcccttggcagc
atgaggcctcccatcatcatccaccgagctggcaagaagtatggcttcaccctgcgggcc
attcgcgtctacatgggtgactccgatgtctacaccgtgcaccatatggtgtggcacgtg
gaggatggaggtccggccagtgaggcagggcttcgtcaaggtgacctcatcacccatgtc
aatggggaacctgtgcatggcctggtgcacacggaggtggtagagctgatcctgaagagt
ggaaacaaggtggccatttcaacaactcccctggagaacacatccattaaagtggggcca
gctcggaagggcagctacaaggccaagatggcccgaaggagcaagaggagccgcggcaag
gatgggcaagaaagcagaaaaaggagctccctgttccgcaagatcaccaagcaagcatcc
ctgctccacaccagccgcagcctttcttcccttaaccgctccttgtcatcaggggagagt
gggccaggctctcccacacacagccacagcctttccccccgatctcccactcaaggctac
cgggtgacccccgatgctgtgcattcagtgggagggaattcatcacagagcagctccccc
agctccagcgtgcccagttccccagccggctctgggcacacacggcccagctccctccac
ggtctggcacccaagctccaacgccagtaccgctctccacggcgcaagtcagcaggcagc
atcccactgtcaccactggcccacaccccttctcccccacccccaacagcttcacctcag
cggtccccatcgcccctgtctggccatgtagcccaggcctttcccacaaagcttcacttg
tcacctcccctgggcaggcaactctcacggcccaagagtgcggagccaccccgttcacca
ctactcaagagggtgcagtcggctgagaaactggcagcagcacttgccgcctctgagaag
aagctagccacttctcgcaagcacagccttgacctgccccactctgaactaaagaaggaa
ctgccgcccagggaagtgagccctctggaggtagttggagccaggagtgtgctgtctggc
aagggggccctgccagggaagggggtgctgcagcctgctccctcacgggccctaggcacc
ctccggcaggaccgagccgaacgacgggagtcgctgcagaagcaagaagccattcgtgag
gtggactcctcagaggacgacaccgaggaagggcctgagaacagccagggtgcacaggag
ctgagcttggcacctcacccagaagtgagccagagtgtggcccctaaaggagcaggagag
agtggggaagaggatcctttcccgtccagagaccctaggagcctgggcccaatggtccca
agcctattgacagggatcacactggggcctcccagaatggaaagtcccagtggtccccac
aggaggctcgggagcccacaagccattgaggaggctgccagctcctcctcagcaggcccc
aacctaggtcagtctggagccacagaccccatccctcctgaaggttgctggaaggcccag
cacctccacacccaggcactaacagcactttctcccagcacttcgggactcacccccacc
agcagttgctctcctcccagctccacctctgggaagctgagcatgtggtcctggaaatcc
cttattgagggcccagacagggcatccccaagcagaaaggcaaccatggcaggtgggcta
gccaacctccaggatttggaaaacacaactccagcccagcctaagaacctgtctcccagg
gagcaggggaagacacagccacctagtgcccccagactggcccatccatcttatgaggat
cccagccagggctggctatgggagtctgagtgtgcacaagcagtgaaagaggatccagcc
ctgagcatcacccaagtgcctgatgcctcaggtgacagaaggcaggacgttccatgccga
ggctgccccctcacccagaagtctgagcccagcctcaggaggggccaagaaccagggggc
catcaaaagcatcgggatttggcattggttccagatgagcttttaaagcaaacatag

DBGET integrated database retrieval system