KEGG   Homo sapiens (human): 23145Help
Entry
23145             CDS       T01001                                 

Gene name
SSPO
Definition
(RefSeq) SCO-spondin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_1 VWD TIL C8 Ldl_recept_a Pacifastin_I F5_F8_type_C VWC
Motif
Other DBs
NCBI-GeneID: 23145
NCBI-ProteinID: NP_940857
OMIM: 617356
HGNC: 21998
Ensembl: ENSG00000197558
Pharos: A2VEC9(Tdark)
UniProt: A2VEC9
Position
7q36.1
AA seq 5147 aa AA seqDB search
MLLPALLFGMAWALADGRWCEWTETIRVEEEVAPRQEDLVPCASLDHYSRLGWRLDLPWS
GRSGLTRSPAPGLCPIYKPPETRPAKWNRTVRTCCPGWGGAHCTEALAKASPEGHCFAMW
QCQLQAGSANASAGSLEECCARPWGQSWWDGSSQACRSCSSRHLPGSASSPALLQPLAGA
VGQLWSQHQRPSATCASWSGFHYRTFDGRHYHFLGRCTYLLAGAADSTWAVHLTPGDRCP
QPGHCQRVTMGPEEVLIQAGNVSVKGQLVPEGQSWLLHGLSLQWLGDWLVLSGGLGVVVR
LDRTGSISISVDHELWGQTQGLCGLYNGWPEDDFMEPGGGLAMLAATFGNSWRLPGSESG
CLDAVEVAQGCDPLGLIDADVEPGHLRAEAQDVCHQLLEGPFGQCHAQVSPAEYHEACLF
AYCAGAMAGSGQEGRQQAVCATFASYVQACARRHIHIRWRKPGFCERLCPGGQLYSDCVS
LCPPSCEAVGQGEEESCREECVSGCECPRGLFWNGTLCVPAAHCPCYYCRQRYVPGDTVR
QLCNPCVCRDGRWHCAQALCPAECAVGGDGHYLTFDGRSYSFWGGQGCRYSLVQDYVKGQ
LLILLEHGACDAGSCLHAISVSLEDTHIQLRDSGAVLVNGQDVGLPWIGAEGLSVRRASS
AFLLLRWPGAQVLWGLSDPVAYITLDPRHAHQVQGLCGTFTQNQQDDFLTPAGDVETSIA
AFASKFQVAGKGRCPSEDSALLSPCTTHSQRHAFAEAACAILHSSVFQECHRLVDKEPFY
LRCLAAVCGCDPGSDCLCPVLSAYARRCAQEGASPPWRNQTLCPVMCPGGQEYRECAPAC
GQHCGKPEDCGELGSCVAGCNCPLGLLWDPEGQCVPPSLCPCQLGARRYAPGSATMKECN
RCICQERGLWNCTARHCPSQAFCPRELVYAPGACLLTCDSPSANHSCPAGSTDGCVCPPG
TVLLDERCVPPDLCPCRHSGQWYLPNATIQEDCNVCVCRGRQWHCTGQRRSGRCQASGAP
HYVTFDGLAFTYPGACEYLLVREASGLFTVSAQNLPCGASGLTCTKALAVRLEGTVVHML
RGRAVTVNGVSVTPPKVYTGPGLSLRRAGLFLLLSTHLGLTLLWDGGTRVLVQLSPQFRG
RVAGLCGDFDGDASNDLRSRQGVLEPTAELAAHSWRLSPLCPEPGDLPHPCTMNTHRAGW
ARARCGALLQPLFTLCHAEVPPQQHYEWCLYDACGCDSGGDCECLCSAIATYADECARHG
HHVRWRSQELCSLQCEGGQVYEACGPTCPPTCHEQHPEPGWHCQVVACVEGCFCPEGTLL
HGGACLEPASCPCEWGRNSFPPGSVLQKDCGNCTCQEGQWHCGGDGGHCEELVPACAEGE
ALCQENGHCVPHGWLCDNQDDCGDGSDEEGCAAPGCGEGQMTCSSGHCLPLALLCDRQDD
CGDGTDEPSYPCPQGLLACADGRCLPPALLCDGHPDCLDAADEESCLGQVTCVPGEVSCV
DGTCLGAIQLCDGVWDCPDGADEGPGHCPLPSLPTPPASTLPGPSPGSLDTASSPLASAS
PAPPCGPFEFRCGSGECTPRGWRCDQEEDCADGSDERGCGGPCAPHHAPCARGPHCVSPE
QLCDGVRQCPDGSDEGPDACGGLPALGGPNRTGLPCPEYTCPNGTCIGFQLVCDGQPDCG
RPGQVGPSPEEQGCGAWGPWSPWGPCSRTCGPWGQGRSRRCSPLGLLVLQNCPGPEHQSQ
ACFTAACPVDGEWSTWSPWSVCSEPCRGTMTRQRQCHSPQNGGRTCAALPGGLHSTRQTK
PCPQDGCPNATCSGELMFQPCAPCPLTCDDISGQVTCPPDWPCGSPGCWCPEGQVLGSEG
WCVWPRQCPCLVDGARYWPGQRIKADCQLCICQDGRPRRCRLNPDCAVDCGWSSWSPWAK
CLGPCGSQSIQWSFRSSNNPRPSGRGRQCRGIHRKARRCQTEPCEGCEHQGQVHRVGERW
HGGPCRVCQCLHNLTAHCSPYCPLGSCPQGWVLVEGTGESCCHCALPGENQTVQPMATPA
AAPAPSPQIRFPLATYILPPSGDPCYSPLGLAGLAEGSLHASSQQLEHPTQAALLGAPTQ
GPSPQGWHAGGDAYAKWHTRPHYLQLDLLQPRNLTGILVPETGSSNAYASSFSLQFSSNG
LHWHDYRDLLPGILPLPKLFPRNWDDLDPAVWTFGRMVQARFVRVWPHDVHHSDVPLQVE
LLGCEPGSPPAPLCPGVGLRCASGECVLRGGPCDGVLDCEDGSDEEGCVLLPEGTGRFHS
TAKTLALSSAQPGQLLHWPREGLAETEHWPPGQESPTSPTETRPVSPGPASGVPHHGESV
QMVTTTPIPQMEARTLPPGMAAVTVVPPHPVTPATPAGQSVAPGPFPPVQCGPGQTPCEV
LGCVEQAQVCDGREDCLDGSDERHCARNLLMWLPSLPALWAASTVPFMMPTMALPGLPAS
RALCSPSQLSCGSGECLSAERRCDLRPDCQDGSDEDGCVDCVLAPWSVWSSCSRSCGLGL
TFQRQELLRPPLPGGSCPRDRFRSQSCFVQACPVAGAWAMWEAWGPCSVSCGGGHQSRQR
SCVDPPPKNGGAPCPGASQERAPCGLQPCSGGTDCELGRVYVSADLCQKGLVPPCPPSCL
DPKANRSCSGHCVEGCRCPPGLLLHDTRCLPLSECPCLVGEELKWPGVSFLLGNCSQCVC
EKGELLCQPGGCPLPCGWSAWSSWAPCDRSCGSGVRARFRSPSNPPAAWGGAPCEGDRQE
LQGCHTVCGTEVFGWTPWTSWSSCSQSCLAPGGGPGWRSRSRLCPSPGDSSCPGDATQEE
PCSPPVCPVPSIWGLWAPWSTCSAPCDGGIQTRGRSCSSLAPGDTTCPGPHSQTRDCNTQ
PCTAQCPENMLFRSAEQCHQEGGPCPRLCLTQGPGIECTGFCAPGCTCPPGLFLHNASCL
PRSQCPCQLHGQLYASGAMARLDSCNNCTCVSGKMACTSERCPVACGWSPWTLWSLCSCS
CNVGIRRRFRAGTAPPAAFGGAECQGPTMEAEFCSLRPCPGPGGEWGPWSPCSVPCGGGY
RNRTRGSSRSLMEFSTCGLQPCAGPVPGMCPRDKQWLDCAQGPASCAELSAPRGTNQTCH
PGCHCPSGMLLLNNVCVPTQDCPCAHEGHLYPPGSTVVRPCENCSCVSGLIANCSSWPCA
EGEPTWSPWTPWSQCSASCGPARCHRHRFCARSPSAVPSTVAPLPLPATPTPLCSGPEAE
EEPCLLQGCDRAGGWGPWGPWSHCSRSCGGGLRSRTRACDQPPPQGLGDYCEGPRAQGEV
CQALPCPVTNCTAIEGAEYSPCGPPCPRSCDDLVHCVWRCQPGCYCPPGQVLSSNGAICV
QPGHCSCLDLLTGQRHHPGARLARPDGCNHCTCLEGRLNCTDLPCPVPGGWCPWSEWTMC
SQPCRGQTRSRSRACACPTPQHGGAPCTGEAGEAGAQHQREACPSYATCPVDGAWGPWGP
WSPCDMCLGQSHRSRACSRPPTPEGGRPCPGNHTQSRPCQENSTQCTDCGGGQSLHPCGQ
PCPRSCQDLSPGSVCQPGSVGCQPTCGCPLGQLSQDGLCVPPAHCRCQYQPGAMGIPENQ
SRSAGSRFSSWESLEPGEVVTGPCDNCTCVAGILQCQEVPDCPDPGVWSSWGPWEDCSVS
CGGGEQLRSRRCARPPCPGPARQSRTCSTQVCREAGCPAGRLYRECQPGEGCPFSCAHVT
QQVGCFSEGCEEGCHCPEGTFQHRLACVQECPCVLTAWLLQELGATIGDPGQPLGPGDEL
DSGQTLRTSCGNCSCAHGKLSCSLDDCFEADGGFGPWSPWGPCSRSCGGLGTRTRSRQCV
LTMPTLSGQGCRGPRQDLECPSPDCPGAEGSTVEPVTGLPGGWGPWSSWSPCSRSCTDPA
RPAWRSRTRLCLANCTMGDPLQERPCNLPSCTELPVCPGPGCGAGNCSWTSWAPWEPCSR
SCGVGQQRRLRAYRPPGPGGHWCPNILTAYQERRFCNLRACPVPGGWSRWSPWSWCDRSC
GGGQSLRSRSCSSPPSKNGGAPCAGERHQARLCNPMPCEAGCPAGMEVVTCANRCPRRCS
DLQEGIVCQDDQVCQKGCRCPKGSLEQDGGCVPIGHCDCTDAQGHSWAPGSQHQDACNNC
SCQAGQLSCTAQPCPPPTHCAWSHWSAWSPCSHSCGPRGQQSRFRSSTSGSWAPECREEQ
SQSQPCPQPSCPPLCLQGTRSRTLGDSWLQGECQRCSCTPEGVICEDTECAVPEAWTLWS
SWSDCPVSCGGGNQVRTRACRAAAPHHRSPPCLGPDTQTRQQPCPGLLEACSWGPWGPCS
RSCGPGLASRSGSCPCLMAKADPTCNSTFLHLDTQGCYSGPCPEECVWSSWSSWTRCSCR
VLVQQRYRHQGPASRGARAGAPCTRLDGHFRPCLISNCSEDSCTPPFEFHACGSPCAGLC
ATHLSHQLCQDLPPCQPGCYCPKGLLEQAGGCIPPEECNCWHTSAAGAGMTLAPGDRLQL
GCKECECRRGELHCTSQGCQGLLPLSEWSEWSPCGPCLPPSALAPASRTALEEHWLRDPT
GLSPTLAPLLASEQHRHRLCLDPATGRPWTGAPHLCTAPLSQQRLCPDPGACPDSCQWSL
WGPWSPCQVPCSGGFRLRWREAEALCGGGCREPWAQESCNGGPCPECEAQDTVFTLDCAN
QCPHSCADLWDRVQCLQGPCRPGCRCPPGQLVQDGRCVPISSCRCGLPSANASWELAPAQ
AVQLDCQNCTCVNESLVCPHQECPVLGPWSAWSSCSAPCGGGTMERHRTCEGGPGVAPCQ
AQDTEQRQECNLQPCPECPPGQVLSACATSCPCLCWHLQPGAICVQEPCQPGCGCPGGQL
LHNGTCVPPTACPCTQHSLPWGLTLTLEEQAQELPPGTVLTRNCTRCVCHGGAFSCSLVD
CQVPPGETWQQVAPGELGLCEQTCLEMNATKTQSNCSSARASGCVCQPGHFRSQAGPCVP
EDHCECWHLGRPHLPGSEWQEACESCLCLSGRPVCTQHCSPLTCAQGEEMVLEPGSCCPS
CRREAPEEQSPSCQLLTELRNFTKGTCYLDQVEVSYCSGYCPSSTHVMPEEPYLQSQCDC
CSYRLDPESPVRILNLRCLGGHTEPVVLPVIHSCQCSSCQGGDFSKR
NT seq 15444 nt NT seq  +upstreamnt  +downstreamnt
atgctactccctgccctcctctttgggatggcgtgggccctggctgacgggcggtggtgt
gagtggacagagaccatccgtgtggaggaggaagtggcaccccgtcaggaggacctggta
ccctgtgccagcctcgaccattacagccgcctgggctggcggctggacctgccctggagt
ggccgctcggggcttacccggtccccagcgcctgggctctgtcctatctacaaacctcca
gaaacccggcctgccaagtggaaccggacagtgaggacttgttgcccaggctgggggggc
gcccactgcactgaggcccttgccaaagccagtcctgaaggccactgctttgccatgtgg
cagtgccagctacaggcaggctcagctaatgcctcagcaggaagcctggaggagtgctgc
gcccggccctggggacaaagctggtgggatggcagctcccaggcctgccgcagctgctcc
agccgacacctgccaggcagtgcctcttctccagccctcctgcagcccctggcaggggct
gtgggccagctctggagccagcaccagcgtccctcggccacctgtgcctcctggtcgggc
ttccactaccgcacctttgatggccgccactatcacttcctgggccgctgcacctacctg
ctggcgggtgctgcggactccacctgggctgtccacctaacacccggggaccgctgcccc
cagcctggacactgtcagcgggtgactatgggacccgaggaggtgctgatccaggctgga
aatgtgtctgtgaaggggcagctggtacctgaagggcagtcttggctgctccacgggctg
agcctgcaatggctgggggactggctggtgctgtcaggaggcctgggggtcgtggtgcgg
ctggacaggactggctccatctccatctctgtggaccacgagctctggggacagacacaa
ggcctctgtgggctctacaatggctggccagaggatgacttcatggagccaggcggaggg
ctggccatgttagcagccacctttggaaattcctggaggctccctggctcggagtctggg
tgtctggatgcagtggaggtggcccagggctgtgaccccctggggctcatagacgcagat
gtagaacctggccacctgcgggctgaagcccaggacgtgtgccatcagctgctggaaggt
ccattcgggcagtgccatgcccaggtttcccctgctgagtaccacgaggcctgtctcttt
gcctactgcgcaggggccatggcaggcagtgggcaagaggggcggcagcaggctgtttgt
gccacctttgccagctatgtccaggcctgtgccaggcggcacatccacattcgctggagg
aagcctggcttctgcgagcgcctgtgccccgggggccagctctactccgactgcgtctcc
ctctgcccacccagctgcgaggcggtgggtcagggagaggaggagtcctgcagggaagag
tgtgtgagtggctgtgagtgcccgcgaggcctcttctggaatggcaccctctgtgtgcct
gctgcccactgcccctgctactactgccgccagcgctatgtacccggtgacaccgtgcgc
cagctgtgtaacccctgcgtgtgcagggatggccgctggcactgtgcccaggcactgtgc
cccgccgagtgtgcagtgggtggggacgggcactacctcaccttcgatgggcggagctac
tccttctggggtggtcaaggttgccgctacagcctggtgcaggactatgtgaagggacag
ctactgatcctactggagcatggggcctgcgacgctgggagctgcctgcacgccatctcc
gtctccctggaggacacccacatccagctcagggactcaggagctgtgctggtcaatggg
caggatgtgggcttgccctggattggcgctgagggcctcagtgtgcgccgagcttcctct
gcctttctgctgctgcgctggcctggggcccaggtgctctggggactgtctgaccctgta
gcctacatcaccctggacccccgccatgcccaccaggtgcagggtctgtgtggcaccttc
acccagaaccagcaggacgacttcctgacaccagccggagatgtggaaactagcattgct
gcctttgctagcaagttccaggtggccggcaagggaagatgcccctctgaggacagtgcc
ctgctgtctccctgcaccacccactcccagcgccacgccttcgcagaggcggcctgtgcc
atcctgcacagctctgtcttccaggaatgccacaggctggtggacaaagagccattctat
ctgcgctgcctggcagccgtgtgtggctgtgatcccggcagtgactgcctgtgcccggtg
ctgtctgcctatgcgcgtcgctgtgcccaggaaggtgcctcacctccctggaggaaccag
accctctgccctgttatgtgtcctggtggccaggagtaccgagagtgtgccccagcatgc
ggtcaacactgcgggaaaccagaggactgtggagagctgggcagctgtgtggctggttgt
aactgtcctctggggctgctgtgggaccctgagggccagtgtgtgccccccagcttgtgc
ccctgccagctcggagcccgtcgctatgcccctggcagtgccaccatgaaggagtgcaac
cgctgcatctgccaggaaaggggcctctggaattgcacggctcgccactgcccttcacag
gcattctgccccagggagcttgtctatgcccctggtgcctgtctcctcacctgtgacagc
cccagcgccaatcactcctgccctgcaggcagtactgatggctgtgtctgtccaccaggc
acggtgctgctggacgagcgctgtgtgcctcctgacctctgtccctgccgtcacagtggg
cagtggtacctgcccaacgccaccatccaggaagactgcaacgtttgcgtgtgccggggc
cggcagtggcactgcacaggccagcggcgcagtgggcggtgccaggcatcaggcgccccc
cactatgtgacatttgacggactggccttcacctatcctggggcctgcgagtatctgctg
gtgcgagaggccagtggcctattcacagtctctgcccagaacctgccctgtggggccagc
ggtctcacctgcaccaaagcgctggccgtgcgtctggagggcactgttgtgcacatgctc
agaggccgggcagtgacggtgaatggggtgagcgtgacgccccccaaggtctacacaggc
cctgggctgagcctgcgtcgtgctggcctcttcctgctgctctcgacccacctgggcctc
accctgctctgggatggagggactcgggtcctggtgcaactgtcccctcagttccgtggt
cgcgtggctgggctgtgtggtgactttgatggagatgccagtaatgatctgcggagccgc
cagggcgtcctggagcccacagctgaactggctgcccactcctggcgcctcagccccctc
tgccctgagccaggagacctgccacacccctgcacgatgaacacacaccgggctggttgg
gctcgggcccgctgtggggcgctgctgcagccgctcttcacattatgccacgcggaggtc
cccccgcagcagcactatgagtggtgcctgtatgacgcctgcggctgcgactcggggggt
gactgtgagtgcctctgctcggccattgccacctatgcagatgagtgtgcccggcatggg
caccacgtgcgctggcgtagccaggagctctgctccctgcagtgtgaagggggacaggta
tatgaggcctgtggccccacgtgtccccccacctgccatgagcagcatcctgagcccggg
tggcactgccaggtggtggcctgtgtggagggctgcttctgccccgaggggactctgctg
cacggaggagcctgcttggagccagcttcctgcccctgtgagtggggccgcaactccttc
ccgccggggtctgtgctgcaaaaggactgcgggaactgcacgtgccaggaaggtcaatgg
cattgtgggggtgacggtggccactgtgaggagcttgtgcctgcctgtgcagagggagag
gccctgtgccaagagaatgggcactgtgtgccccatgggtggctttgtgacaaccaggac
gactgtggcgatggctctgatgaggagggttgtgccgccccaggctgtggggaggggcag
atgacttgcagctccggccactgcctgcccctggccctgctctgtgaccgccaggatgac
tgtggagatggcacggatgagccgagctatccgtgcccccagggcttgctggcctgtgcc
gatggacgctgcctgccgccggccctgctctgcgatgggcatcctgactgtctggatgcc
gccgacgaggagtcctgtctggggcaggtgacctgcgtccccggggaggtgtcctgtgtt
gatggcacctgcctgggggccatccagctgtgtgacggagtctgggactgcccagatgga
gccgatgaggggccgggacactgccccctaccttctctgcccacacctcctgccagcacc
ttgcctggcccctccccaggctccctggacactgcgtcaagtcccctggccagcgccagc
cctgcgccaccctgcggccccttcgagtttcggtgcggcagcggcgagtgcaccccgcgg
ggctggcgctgcgaccaggaggaagactgcgccgacggcagcgacgagcgcggctgcgga
gggccctgcgcgccgcaccacgcgccctgcgcccgcggccctcactgcgtgtcccccgag
cagctgtgcgacggcgtgcggcagtgtcccgacggctcggacgagggccccgacgcctgc
ggggggctgccagccctgggaggccccaacaggacagggcttccctgcccagaatacacc
tgccccaatggcacctgcataggcttccagctggtgtgtgatgggcagcctgactgtgga
aggccagggcaggtgggcccctccccagaagagcagggttgtggggcctggggcccctgg
agcccatgggggccctgcagccggacgtgtgggccctggggccagggccggagccgccgc
tgctccccactcggcctcctggtgctacagaactgcccagggcctgagcaccagtctcag
gcctgcttcacggcagcctgcccagtggacggtgaatggagcacctggtccccctggtct
gtgtgctctgagccgtgcaggggcaccatgacgcggcaacggcagtgccactcaccccag
aatgggggccgcacctgtgctgcactgcccggaggcctgcacagcacccgccagaccaag
ccttgccctcaggacggctgccccaatgccacttgctctggggagctgatgttccagccc
tgtgccccctgcccactgacctgtgatgacatctctggccaggtcacgtgcccacctgat
tggccctgcggcagcccgggctgctggtgcccagaagggcaggtgctgggcagcgagggg
tggtgtgtgtggccccggcagtgcccctgcctggtggacggtgcccgctactggcctggg
caacgcatcaaggccgactgccagctctgcatctgccaagacggacggccccgacgctgc
cgactcaacccggactgcgctgtggactgtggctggtcctcctggtcaccctgggccaag
tgcctgggcccctgtggaagccagagcatccagtggtccttccggagctccaacaacccc
cgcccctccggccgaggtcgccagtgccgtggcatccaccgcaaggcacgcaggtgccag
acggagccctgtgaggggtgtgagcatcagggccaggtccaccgtgtcggggaacgctgg
catgggggcccctgcagggtgtgccagtgtctgcacaacctcaccgcacactgctcaccc
tactgcccgctcggcagctgcccccagggctgggtcttggtggaggggacgggagaatca
tgctgccactgtgccctacctggagagaaccagacggtccagcccatggccactcctgcc
gcagctccggctcccagtccccagatcagattccctttggccacttacattctgcctccg
tcaggagacccctgctattctcccctggggctggccggactggctgaggggagtctgcat
gcatcgtcccagcagctggaacaccccacccaggctgccctcctgggggctcccacccag
gggcccagccctcagggatggcacgctggaggggatgcttatgccaagtggcacactcgg
ccccattacctgcagctggacctgcttcagcctcggaacctcactggcatcctagtgccg
gagactggctcctccaacgcatatgccagcagcttctcactccagttcagcagcaatggt
ctacactggcatgactatcgtgacctcctgcctggcatcttgcccctgcccaagcttttc
cccagaaactgggatgacctggaccctgccgtatggactttcggccgcatggtgcaggcg
aggtttgtcagggtgtggccccacgatgtccaccacagcgatgtccccctgcaggtggag
ctgctgggctgcgagccagggtccccaccggcacctctgtgcccaggggttggactccgc
tgtgccagtggtgagtgtgtcctgagagggggcccttgtgacggtgttctggactgcgag
gatggctcggatgaggagggctgtgtgttgctgcctgagggcactggcagattccattcc
acagccaagaccctggccctctcctctgcccagccggggcagctgctgcactggcccagg
gagggcctggcagagactgagcactggccccctgggcaggaatcccccacgtccccgaca
gagacaaggcccgtgagtcctggcccagcctccggggtgcctcaccatggggaatctgtg
cagatggtgaccaccacccccataccccagatggaggccaggaccctgccaccaggtatg
gcagctgtgacggtggtgcccccacaccctgtgactccagcgacccctgctggccagagc
gtcgccccaggacccttcccacctgtgcagtgtggccccggccagacgccctgtgaggtg
ctgggctgcgtggaacaggcgcaggtgtgtgatggcagggaggattgcctcgacggctcc
gacgagaggcactgcgccaggaatctacttatgtggctcccttctctccctgccttgtgg
gcagcgagcactgtgcccttcatgatgcctaccatggccctgcctgggcttccagcctca
agggccctctgttccccgagccagctgagctgtggcagcggggagtgtctgtctgctgag
cggcgctgtgacctgcggcctgactgccaggatggctcggacgaggatggctgtgtggac
tgcgtgctggccccctggtctgtctggagcagctgcagccgcagctgtggcctgggcctc
accttccagcgccaggagctgctgcggcctcctctgccagggggcagctgcccgcgtgac
cggttccgaagccagtcctgctttgtgcaggcctgcccagtggctggggcatgggccatg
tgggaggcctggggaccctgcagcgtctcctgcgggggtggccatcagagtcgccagaga
agctgtgtggaccccccacccaagaatggcggtgccccctgccccggggcctcccaagag
agggcaccctgcggcttgcagccctgctcaggtggcacagactgcgagctgggccgtgtg
tatgtgagtgccgatctgtgccagaaggggctggtgcccccatgcccaccctcctgcctg
gatcccaaggccaacagaagctgcagtgggcattgtgtggaaggatgccgctgtcccccg
gggctccttctgcatgacactcgctgcctgcccctctctgagtgcccctgcctggtgggc
gaagagctgaagtggccaggggtgtccttcctcctgggcaactgcagccaatgcgtgtgt
gagaagggggagttgctgtgccaaccagggggctgccccctgccctgcggctggtcagcc
tggtcctcctgggctccctgcgaccgctcctgtggctctggagtgagggccaggttcagg
tctccctccaaccctccggcagcctgggggggtgccccgtgtgaaggtgaccggcaggaa
ctgcagggctgccacacagtgtgtgggacagaggtgttcggctggacgccctggacttcc
tggtcctcctgctcccaaagctgccttgccccgggagggggccctggctggcgcagtcgt
tcccgactctgccccagccctggggattcatcctgcccaggagatgccacccaggaggag
ccctgcagcccccctgtatgcccagtgccaagcatctggggtctgtgggctccctggtcc
acttgctcagccccctgtgatggaggcatccagacacgtgggcgcagctgctccagcttg
gctccaggggacaccacgtgcccaggaccccacagtcagaccagggactgcaacacgcag
ccctgcacagcccagtgcccagagaacatgttgttccgctcagcagagcagtgtcaccag
gaggggggtccttgccctcggctatgcctgacgcagggccccgggatagagtgtacgggc
ttctgcgcccccggctgcacctgcccccctggtcttttcctgcacaatgctagctgcctg
ccccgcagccagtgcccctgccagctgcacgggcagctctatgcatcaggagcaatggct
cgcctggactcctgcaacaactgcacctgtgtctctggtaagatggcatgcacctcggag
cgctgcccagtggcctgtggctggagtccctggaccctgtggagtctctgtagctgcagc
tgcaacgtgggcattcggcgccgcttccgggcaggcactgcacccccagctgcctttggg
ggtgctgagtgccaaggccccaccatggaggctgaattctgcagcctgcggccatgtcca
ggtcctggtggggagtggggcccttggtctccgtgctccgtgccctgtggtggtggctac
aggaaccgcacccgaggcagcagccgcagcctcatggagttttccacctgtggcctgcag
ccctgcgcagggccagtgcctggcatgtgtcccagggacaagcagtggctggactgtgcc
cagggccctgcctcttgtgcagagctcagcgccccaagagggactaaccagacctgccac
cctggctgccactgcccctctgggatgcttctgctgaacaacgtgtgtgtgcccacccag
gactgcccctgtgcccacgaggggcacctctaccccccgggcagcactgtggttcgtcca
tgtgaaaactgctcctgtgtctccgggctcatcgccaactgcagctcctggccttgtgcg
gagggtgagcccacgtggtcaccctggaccccttggagccagtgttcagcctcctgtggc
cctgcccggtgccatcggcaccggttctgtgccaggtcccccagtgcagtgccatccacc
gtggctccgctgcccctgccagccacccccacacctctctgctcaggccccgaggctgaa
gaggagccatgtctcctgcaggggtgtgatcgagctgggggatggggtccatgggggccc
tggtcccactgtagccggagctgtgggggaggcctgcggagccggacccgggcctgtgac
cagcccccaccccagggcctgggggattactgcgaggggccacgggcacagggggaggtc
tgccaggctctgccctgcccagtgaccaactgcactgccattgaaggggccgagtatagc
ccctgtggccctccgtgccctcgctcctgtgatgacctagtgcactgcgtgtggcgctgc
cagcctggctgctactgcccaccaggccaggtactgagttccaacggggccatctgcgtg
cagccgggtcactgcagctgcctggacctgctgaccgggcagcggcaccatccgggtgct
cggctggcaaggcctgacggctgcaaccactgcacctgcctggaggggaggctgaactgc
acagacctgccctgcccagtgcccggaggctggtgcccgtggtcggagtggacaatgtgc
tcccagccctgcaggggccagaccaggagccgctccagggcctgtgcctgccccactcct
cagcacggtggtgccccgtgcactggagaggctggggaggcaggggcccagcatcagagg
gaggcctgccccagctacgccacgtgcccagtggacggagcctggggcccatgggggcca
tggtctccctgcgacatgtgcttggggcagtcccaccggagccgggcgtgcagccggccc
cccacccctgagggagggaggccctgccctgggaaccacacgcagagtcgcccttgccag
gaaaattccacccagtgcacagactgcgggggtggccagagtctgcatccctgtgggcag
ccctgcccccgctcctgccaggacctgtcccctgggagtgtgtgccagccaggctctgtg
ggctgccagcccacttgtgggtgccccctgggccagctctcccaggacgggctgtgcgtg
cccccagcccactgccgctgccagtaccagcctggagccatggggatccctgagaaccag
agccgctcagcagggtctaggtttagctcctgggagagcctggaacccggagaggtggtc
actgggccatgtgacaactgcacctgtgtggcaggcattctgcaatgccaggaggtgcct
gactgcccggaccctggggtgtggagctcttggggcccttgggaagactgcagtgtttcg
tgtgggggcggggagcagctgcgctcccggcgctgtgctcgtcctccctgcccagggcct
gcccgccagagccgcacatgcagcacacaggtctgcagagaggcaggctgcccggctggc
cgcctgtaccgtgaatgccagcccggcgagggatgccccttctcctgcgcccacgtcacg
cagcaggtgggctgcttctctgagggctgcgaggagggctgccactgccccgagggcacc
ttccagcaccgcctggcctgtgtgcaggagtgcccttgtgtgctgacagcctggctgctg
caggagctgggagccaccataggtgaccctggtcagcccctcgggcctggagatgagctg
gactcaggccagacacttcgtacaagctgtggcaactgctcgtgtgcacacgggaagctg
tcttgctccctggacgactgcttcgaggccgatggtggtttcggtccctggagcccgtgg
ggcccgtgctcccgctcctgtggagggctgggcacccgtacccgcagccgccagtgtgtg
ctcaccatgcccaccctcagtggtcagggctgccgtgggccccgccaggacctcgagtgc
cccagcccagactgccctggggctgaagggtccacggtggagccagtaacaggccttcca
ggtggctggggcccatggtcctcctggtccccctgctccagaagctgcacggaccccgct
cgccctgcatggcgcagccgcacccgcctctgcctggctaactgcaccatgggggaccca
ttacaggagcgcccctgcaacctgccctcatgcacagagctgcccgtgtgccctggccct
ggctgtggggctgggaactgttcctggacctcctgggccccgtgggaaccttgctcccgc
agctgcggagtgggccagcagcgccgcctgcgggcataccgtccccctgggcccggcggg
cactggtgccccaacatccttactgcctaccaagagcgccgcttctgcaacctgcgagcc
tgcccagtgcccgggggctggtcacgctggagtccctggtcctggtgtgaccgcagctgt
gggggaggccaatccctgagaagccgcagctgctcaagccccccatccaagaacggggga
gccccctgtgctggggagcggcaccaggcccgcctctgcaatcccatgccttgtgaggcc
ggctgcccagcaggcatggaggtggtcacctgtgccaaccgctgcccccgccgctgctca
gacctccaggagggaattgtgtgtcaggacgaccaggtctgccagaagggctgccgctgc
ccaaaggggtccctggagcaggatggtggctgcgtgccaattgggcactgtgactgcacc
gatgcccagggccacagctgggccccggggagccagcaccaggatgcctgcaacaactgc
tcatgccaagctgggcagctctcctgcacggctcagccctgcccgcctcccacccactgt
gcctggagccactggtcggcctggagtccctgcagccactcatgcgggcccagagggcag
cagagccgcttccggtcctccacgtcgggctcgtgggccccagagtgtcgggaggagcag
tcccagagccagccctgccctcagccctcgtgcccacccctgtgcctgcagggcactcgc
tcccgcaccctgggggacagctggctgcagggggagtgccagcggtgctcctgcaccccg
gagggtgtgatctgcgaagatacggagtgtgcagtgcctgaggcttggacgctgtggtcc
tcctggtccgactgccctgtctcctgtggaggtggaaaccaggtccgaacccgggcctgc
agggccgcagcccctcaccacaggagcccaccctgcctgggccctgacacccagaccagg
cagcagccttgcccagggctgctggaggcctgctcctggggcccgtgggggccctgttcc
cgcagctgcggcccgggcctggcctctcgctctgggtcctgcccctgcctgatggccaag
gccgaccccacctgcaacagcaccttcctccacctggacacccagggctgctactcaggg
ccctgcccagaggagtgtgtgtggagcagctggagcagctggacgcgctgctcttgccgg
gtgctggtgcagcagcgctaccgacaccagggcccggcgtcccgaggggccagggcaggc
gccccctgcacgcggctggatggccacttccggccttgccttatcagcaactgctctgag
gacagctgcacgcctccctttgagttccatgcctgcggctccccctgtgctgggctctgt
gccacacacctgagccatcagctctgccaggacctgccaccctgccagccgggctgctac
tgccccaaggggctgctggagcaggctgggggctgcattcccccagaggagtgtaactgc
tggcatacctcagcagcaggagccgggatgaccctggcccctggggaccgcctgcagctg
ggctgtaaggagtgtgaatgccggcgtggggagctgcactgcaccagccagggctgtcaa
ggtcttctgcctctgagtgagtggtccgagtggtcgccctgtgggccctgcctgccgccc
agcgccctggcccctgcctccaggactgccctagaggagcactggctccgagacccaact
ggcctctcccccaccttggccccgctgctggcttcagagcagcaccgccaccggctctgt
ctggatcctgcgacagggaggccctggactggagcccctcacctctgcaccgcacccctc
agccagcagcgcctctgccctgaccctggagcctgccctgactcatgccagtggagtctg
tgggggccatggagcccctgccaggtgccctgcagtggggggttcaggctacgctggaga
gaggcagaggccctctgtggaggaggctgccgggagccatgggctcaagaaagctgcaac
ggagggccctgcccagagtgcgaggcccaagacactgtattcaccctggactgtgccaac
cagtgcccacacagctgtgccgacctctgggaccgcgttcagtgtctgcagggaccctgc
cgcccaggctgccgctgtccccctggccagctggtccaggatgggcgctgtgtgccgatc
tcctcttgccgctgtggcctccccagtgccaatgcctcttgggagctggccccggcccag
gcggtgcagctggactgccaaaactgcacctgtgtcaacgagtccctggtgtgcccacac
caggagtgtccagtccttgggccttggtcagcctggagcagttgctcggccccctgtggt
gggggcactatggagcgacatcggacttgtgaggggggtcctggggtggcaccatgccag
gcccaggacacagagcaacggcaggagtgtaacctgcagccctgccctgagtgcccccct
ggccaggtgcttagtgcctgtgccacctcatgcccgtgcctctgctggcatctgcagcct
ggtgccatctgtgtgcaggagccctgccagcctggctgtggctgccctggagggcagctg
ctgcacaatggcacgtgtgtgcctcccactgcctgcccctgcacccagcattctctgccc
tggggcctcaccctgaccctggaagagcaggcccaggagctgcccccagggactgtgctc
acccggaactgcacccgctgtgtctgccacggtggagccttcagctgctccctcgttgac
tgtcaggtgccccctggggaaacgtggcagcaggtggccccgggggagctggggctctgc
gagcagacgtgcctggagatgaacgccacaaagacccagagtaactgcagttcagctcga
gcctcgggctgcgtgtgccagcccgggcacttccgcagccaggcaggcccctgcgtcccc
gaagaccactgcgagtgctggcaccttgggcgtccccacctgcctggatctgaatggcag
gaggcctgtgagagctgcctctgcctcagtgggaggcctgtctgcacccagcactgctcc
ccactcacctgtgctcagggcgaggagatggtgctggagccagggagctgctgtccctct
tgccgcagggaggctccggaggagcagtcgccctcctgccagctcctcacggagcttcga
aacttcaccaaagggacctgttacctggaccaggtagaagtgagctactgcagtgggtac
tgcccatccagcacccatgtcatgccagaggagccatacctgcagagccagtgtgactgc
tgcagctaccgtctagacccggagagccctgtgcggatcctgaacctgcgctgtctgggt
ggccacacagagcccgtggtgctgccggtcatccacagctgccagtgcagctcctgccag
ggtggggacttctcaaagcgctaa

DBGET integrated database retrieval system