KEGG   Homo sapiens (human): 2315Help
Entry
2315              CDS       T01001                                 

Gene name
MLANA, MART-1, MART1
Definition
(RefSeq) melan-A
  KO
K17303  melanoma antigen recognized by T-cells 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2315 (MLANA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   2315 (MLANA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MLANA DUF417
Motif
Other DBs
NCBI-GeneID: 2315
NCBI-ProteinID: NP_005502
OMIM: 605513
HGNC: 7124
Ensembl: ENSG00000120215
Vega: OTTHUMG00000019510
Pharos: Q16655(Tbio)
UniProt: Q16655
Position
9p24.1
AA seq 118 aa AA seqDB search
MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagaagatgctcacttcatctatggttaccccaagaaggggcacggccactct
tacaccacggctgaagaggccgctgggatcggcatcctgacagtgatcctgggagtctta
ctgctcatcggctgttggtattgtagaagacgaaatggatacagagccttgatggataaa
agtcttcatgttggcactcaatgtgccttaacaagaagatgcccacaagaagggtttgat
catcgggacagcaaagtgtctcttcaagagaaaaactgtgaacctgtggttcccaatgct
ccacctgcttatgagaaactctctgcagaacagtcaccaccaccttattcaccttaa

DBGET integrated database retrieval system